NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS36674.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
36674.1 Public Mus musculus 13 Rgs14 21 106 86 CCDS HistoryNCBI Gene:51791Re-query CCDS DB by CCDS ID:36674.1Re-query CCDS DB by GeneID:51791See the combined annotation on chromosome 13 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 36674.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000063771 ENSMUSP00000068731 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000063771Link to Ensembl Protein Viewer:ENSMUSP00000068731Re-query CCDS DB by Nucleotide ID:ENSMUST00000063771Re-query CCDS DB by Protein ID:ENSMUSP00000068731
Original member Current member EBI,WTSI OTTMUST00000084287 OTTMUSP00000045408 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000084287Link to Vega Protein Viewer:OTTMUSP00000045408Re-query CCDS DB by Nucleotide ID:OTTMUST00000084287Re-query CCDS DB by Protein ID:OTTMUSP00000045408
Original member Current member NCBI NM_016758.3 NP_058038.2 Accepted alive Link to Nucleotide Sequence:NM_016758.3Link to Protein Sequence:NP_058038.2Re-query CCDS DB by Nucleotide ID:NM_016758Re-query CCDS DB by Protein ID:NP_058038Link to BLink:NP_058038.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_058038.2 547 P97492 547 100% 0 0

Chromosomal Locations for CCDS 36674.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 13 (NC_000079.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 13Link to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13See the combined annotation on chromosome 13 in Sequence Viewer

Chromosome Start Stop Links
13 55369892 55369936 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 55378007 55378028 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 55378220 55378398 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 55378702 55378794 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 55378876 55379019 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 55379303 55379446 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 55379580 55379691 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 55380005 55380117 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 55380900 55381103 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 55382845 55382921 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 55383118 55383244 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 55383335 55383416 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 55383525 55383571 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 55383654 55383768 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 55383996 55384135 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1644 nt):
ATGCCAGGGAAGCCCAAGCACTTGGGTGTCCCCAACGGGCGCATGGTTCTGGCTGTCTCAGATGGAGAAC
TG
ACCAGCACTGCAGGTTCCCAGGCCCAGGGTGAGGGCAGAGGCAGCTCTCTCAGCATCCACAGCCTCCC
T
AGTGGCCCCAGCAGCCCCTTCTCCACCGAGGAGCAGCCTGTGGCCAGCTGGGCCCAGTCCTTTGAGCGG
CTG
CTGCAAGACCCACGGGGTCTGGCTTACTTCACTGAGTTCCTGAAGAAGGAATTCAGCGCAGAGAACG
TA
ACTTTCTGGAAAGCCTGCGAACGTTTCCAGCAGATCCCAGCCAGCGACACCAAGCAGCTAGCTCAGGA
G
GCCCACAACATCTACCACGAGTTCCTATCCAGCCAGGCGCTGAGCCCAGTGAACATCGACCGACAGGCC
TGG
CTTAGTGAGGAGGTGCTGGCCCAGCCCCGGCCAGATATGTTCCGAGCACAGCAGCTTCAGATCTTCA
AT
TTGATGAAGTTCGACAGCTATGCGCGCTTCGTCAAATCCCCGCTGTACCAAGAGTGCCTGCTGGCGGA
G
GCCGAGGGACGCCCCCTGCGGGAACCTGGCTCCTCACACCTCGGGAGCCCGGACACAGCGAGGAAGAAG
CCA
AAGCTGAAGCCTGGGAAGTCACTGCCGCTGGGCGTGGAAGAGTTGGGGCAGCTGCCACTCGCTGAGG
GC
CCTTGTGGCCGCCCTCTCCGCAAGTCCTTTCGTAGAGAGATGACAGGTGGAGCCATGAATTCGGCCCT
G
CGACGAGAGTCTCAAGGGTCCCTGAATTCTTCTGCCAGTCTGGACCTGGGTTTCCTTGCCTTTGTGAGC
AGC
AAATCTGAGAGTCACCGGAAGAGCCTTGGAAGTGGAGAGAGTGAGAGCGAGAGTCGGCCGGGGAAGT
AT
TGCTGCGTGTATCTACCTGACGGCACGGCTTCCTTGGCCCTGGCTCGACCTGGCCTCACCATCCGAGA
C
ATGCTGGCAGGCATCTGTGAGAAGAGAGGCCTCTCTCTGCCTGACATTAAGGTCTACCTGGTGGGCAAT
GAA
CAGAAGGCCCTGGTCCTGGATCAGGATTGCACCGTGCTGGCAGACCAGGAAGTGCGACTGGAAAACA
GG
ATCACCTTCCAGCTGGAGTTGGTCGGCCTGGAGCGAGTGGTCCGGATCTCAGCTAAGCCCACCAAGCG
T
CTGCAAGAGGCGCTGCAGCCCATCCTGGCTAAGCATGGCCTGAGCCTGGACCAGGTGGTACTGCACAGG
CCA
GGAGAGAAGCAGCCCATGGATTTGGAGAATCCAGTGAGCTCAGTGGCCTCACAGACACTGGTTTTGG
AC
ACTCCTCCGGATGCAAAGATGAGTGAAGCCAGAAGCATATCCCCCTGCCGCAGTCAGGGATGCCTCCC
A
AGAACCCAGACCAAGGACAGTCACCTTCCCCCATCGTCCTCCAGTTTGCTGGTAGAAGATGCCAGTAGT
TCT
ACTGGGAACCGGCAGACCTGTGACATTGAAGGCCTGGTGGAGCTGCTGAATCGGGTGCAGAGCAGCG
GG
GCCCACGATCAGAGAGGACTTCTTCGCAAAGAGGACCTGGTCCTTCCAGAATTTCTGCAGCTTCCTTC
C
CAAAGACCAGGCTCTCGGGAGGCTCCACCATAG


Translation (547 aa):
MPGKPKHLGVPNGRMVLAVSDGELTSTAGSQAQGEGRGSSLSIHSLPSGPSSPFSTEEQPVASWAQSFER
L
LQDPRGLAYFT
EFLKKEFSAENVTFWKACERFQQIPASDTKQLAQEAHNIYHEFLSSQALSPVNIDRQA
W
LSEEVLAQPRPDMFRAQQLQ
IFNLMKFDSYARFVKSPLYQECLLAEAEGRPLREPGSSHLGSPDTARKK
P
KLKPGKSLPLGVEELGQLPLAEGPCGRPLRKSFRR
EMTGGAMNSALRRESQGSLNSSASLDLGFLAFVS
S
KSE
SHRKSLGSGESESESRPGKYCCVYLPDGTASLALARPGLTIRDMLAGICEKRGLSLPDIKVYLVGN
E
Q
KALVLDQDCTVLADQEVRLENRITFQLELVGLERVVRISAKPTKRLQEALQPILAKHGLSLDQVVLHR
P
GEKQPMDLENPVSSVASQTLVLDTPP
DAKMSEARSISPCRSQGCLPRTQTKDSHLPPSSSSLLVEDASS
S
TGNRQTCDIE
GLVELLNRVQSSGAHDQRGLLRKEDLVLPEFLQLPSQRPGSREAPP



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser