NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS57614.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
57614.1 Public Mus musculus 8 Fgfr1 21 106 86 CCDS HistoryNCBI Gene:14182Re-query CCDS DB by CCDS ID:57614.1Re-query CCDS DB by GeneID:14182See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 10, NCBI annotation release 38.1, Ensembl annotation release 68

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 57614.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000117179 ENSMUSP00000113909 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000117179Link to Ensembl Protein Viewer:ENSMUSP00000113909Re-query CCDS DB by Nucleotide ID:ENSMUST00000117179Re-query CCDS DB by Protein ID:ENSMUSP00000113909
Original member Current member EBI,WTSI OTTMUST00000076867 OTTMUSP00000040526 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000076867Link to Vega Protein Viewer:OTTMUSP00000040526Re-query CCDS DB by Nucleotide ID:OTTMUST00000076867Re-query CCDS DB by Protein ID:OTTMUSP00000040526
Original member Current member NCBI NM_001079908.2 NP_001073377.1 Accepted alive Link to Nucleotide Sequence:NM_001079908.2Link to Protein Sequence:NP_001073377.1Re-query CCDS DB by Nucleotide ID:NM_001079908Re-query CCDS DB by Protein ID:NP_001073377Link to BLAST:NP_001073377.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001073377.1 820 P16092-6 820 100% 0 0

Chromosomal Locations for CCDS 57614.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 8 (NC_000074.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 25532338 25532428 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 25555508 25555774 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 25557731 25557814 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 25558071 25558243 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 25560720 25560843 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 25562138 25562328 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 25564340 25564484 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 25566711 25566913 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 25568188 25568333 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 25569639 25569760 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 25570141 25570251 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 25570710 25570900 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 25572338 25572460 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 25572719 25572789 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 25573123 25573260 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 25573546 25573651 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 25573745 25573921 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2463 nt):
ATGTGGGGCTGGAAGTGCCTCCTCTTCTGGGCTGTGCTGGTCACAGCCACTCTCTGCACTGCCAGGCCAG
CC
CCAACCTTGCCTGAACAAGCTCAGCCCTGGGGAGTCCCTGTGGAAGTGGAGTCTCTCCTGGTCCACCC
T
GGCGACCTGCTACAGCTTCGCTGTCGGCTTCGCGATGATGTGCAGAGCATCAACTGGCTGCGGGATGGG
GTG
CAGCTGGTGGAGAGCAACCGTACCCGCATCACAGGGGAGGAGGTGGAGGTGCGGGACTCCATCCCCG
CT
GACTCTGGCCTCTACGCTTGCGTGACCAGCAGCCCCTCTGGCAGCGATACCACCTACTTCTCCGTCAA
T
GTCTCAGATGCACTCCCATCCTCGGAAGATGATGACGACGACGATGACTCCTCCTCGGAGGAGAAAGAG
ACG
GACAACACCAAACCAAACCCTGTAGCTCCCTACTGGACATCCCCAGAGAAAATGGAGAAGAAACTGC
AT
GCGGTGCCCGCTGCCAAGACGGTGAAGTTCAAGTGCCCGTCGAGTGGGACACCCAACCCCACTCTGCG
C
TGGTTGAAAAATGGCAAAGAGTTTAAGCCTGACCACCGAATTGGAGGCTACAAGGTTCGCTATGCCACC
TGG
AGCATCATAATGGATTCTGTGGTGCCTTCTGACAAGGGCAACTACACCTGCATCGTGGAGAATGAGT
AT
GGGAGCATCAACCACACCTACCAGCTTGACGTCGTGGAACGATCTCCGCACCGACCCATCCTTCAGGC
A
GGGCTGCCTGCCAACAAGACAGTGGCCCTGGGCAGCAATGTGGAGTTCATGTGTAAGGTGTACAGCGAT
CCG
CAGCCTCACATTCAGTGGCTGAAGCACATCGAGGTGAACGGGAGTAAGATCGGGCCAGACAACTTGC
CG
TATGTCCAGATCCTGAAGACTGCTGGAGTTAATACCACCGACAAGGAAATGGAGGTGCTTCATCTACG
G
AATGTCTCCTTTGAGGATGCGGGGGAGTATACGTGCTTGGCGGGTAACTCTATCGGACTCTCCCATCAC
TCT
GCATGGTTGACCGTTCTGGAAGCCCTGGAAGAGAGACCAGCTGTGATGACCTCACCGCTCTACCTGG
AG
ATCATTATCTACTGCACCGGGGCCTTCCTGATCTCCTGCATGTTGGGCTCTGTCATCATCTATAAGAT
G
AAGAGCGGCACCAAGAAGAGCGACTTCCATAGCCAGATGGCTGTGCACAAGCTGGCCAAGAGCATCCCT
CTG
CGCAGACAGGTAACAGTGTCAGCTGACTCCAGTGCATCCATGAACTCTGGGGTTCTCCTGGTTCGGC
CC
TCACGGCTCTCCTCCAGCGGGACCCCCATGCTGGCTGGAGTCTCCGAATATGAGCTCCCTGAGGATCC
C
CGCTGGGAGCTGCCACGAGACAGACTGGTCTTAGGCAAACCACTTGGCGAGGGCTGCTTCGGGCAGGTG
GTG
TTGGCTGAGGCCATCGGGCTGGATAAGGACAAACCCAACCGTGTGACCAAAGTGGCCGTGAAGATGT
TG
AAGTCCGACGCAACGGAGAAGGACCTGTCGGATCTGATCTCGGAGATGGAGATGATGAAAATGATTGG
G
AAGCACAAGAATATCATCAACCTTCTGGGAGCGTGCACACAGGATGGTCCTCTTTATGTCATTGTGGAG
TAC
GCCTCCAAAGGCAATCTCCGGGAGTATCTACAGGCCCGGAGGCCTCCTGGGCTGGAGTACTGCTATA
AC
CCCAGCCACAACCCCGAGGAACAGCTGTCTTCCAAAGATCTGGTATCCTGTGCCTATCAGGTGGCTCG
G
GGCATGGAGTATCTTGCCTCTAAGAAGTGTATACACCGAGACCTGGCTGCTAGGAACGTCCTGGTGACC
GAG
GATAACGTAATGAAGATCGCAGACTTTGGCTTAGCTCGAGACATTCATCATATCGACTACTACAAGA
AA
ACCACCAACGGCCGGCTGCCTGTGAAGTGGATGGCCCCTGAGGCGTTGTTTGACCGGATCTACACACA
C
CAGAGCGATGTGTGGTCTTTTGGAGTGCTCTTGTGGGAGATCTTCACTCTGGGTGGCTCCCCATACCCC
GGT
GTGCCTGTGGAGGAACTTTTCAAGCTGCTGAAGGAGGGTCATCGAATGGACAAGCCCAGTAACTGTA
CC
AATGAGCTGTACATGATGATGCGGGACTGCTGGCATGCAGTGCCCTCTCAGAGACCTACGTTCAAGCA
G
TTGGTGGAAGACCTGGACCGCATTGTGGCCTTGACCTCCAACCAGGAGTATCTGGACCTGTCCATACCG
CTG
GACCAGTACTCACCCAGCTTTCCCGACACACGGAGCTCCACCTGCTCCTCAGGGGAGGACTCTGTCT
TC
TCTCATGAGCCGTTACCTGAGGAGCCCTGTCTGCCTCGACACCCCACCCAGCTTGCCAACAGTGGACT
C
AAACGGCGCTGA


Translation (820 aa):
MWGWKCLLFWAVLVTATLCTARPAPTLPEQAQPWGVPVEVESLLVHPGDLLQLRCRLRDDVQSINWLRDG
V
QLVESNRTRITGEEVEVRDSIPADSGLYACVTSSPSGSDTTYFSVNVS
DALPSSEDDDDDDDSSSEEKE
T
DNTKPN
PVAPYWTSPEKMEKKLHAVPAAKTVKFKCPSSGTPNPTLRWLKNGKEFKPDHRIGGYKVRYAT
W
SIIMDSVVPSDKGNYTCIVENEYGSINHTYQLDVV
ERSPHRPILQAGLPANKTVALGSNVEFMCKVYSD
P
QPHIQWLKHIEVNGSKIGPDNLPYVQILK
TAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHH
S
AWLTVLE
ALEERPAVMTSPLYLEIIIYCTGAFLISCMLGSVIIYKMKSGTKKSDFHSQMAVHKLAKSIP
L
RRQVT
VSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVLGKPLGEGCFGQV
V
LAEAIGLDKDKPNRVTKVAVKMLK
SDATEKDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPLYVIVE
Y
ASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDLVSCAYQVARGMEYLASKK
CIHRDLAARNVLVT
E
DNVMKIADFGLARDIHHIDYYKKTTN
GRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYP
G
VPVEELFKLLKEGHRMDKPSNCTNE
LYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSIP
L
DQYSPSFPDTRSSTCSSGEDSVFSHEPLPEEPCLPRHPTQLANSGLKRR




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser