NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS22126.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
22126.1 Public Mus musculus 8 Agpat5 21 106 86 CCDS HistoryNCBI Gene:52123Re-query CCDS DB by CCDS ID:22126.1Re-query CCDS DB by GeneID:52123See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Public Note for CCDS 22126.1
The coding region has been updated to represent a CDS sequence that is better supported by available transcript data and the reference genome sequence. The protein length is unchanged.

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 22126.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000149565 ENSMUSP00000117025 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000149565Link to Ensembl Protein Viewer:ENSMUSP00000117025Re-query CCDS DB by Nucleotide ID:ENSMUST00000149565Re-query CCDS DB by Protein ID:ENSMUSP00000117025
Original member Current member EBI,WTSI OTTMUST00000076712 OTTMUSP00000040427 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000076712Link to Vega Protein Viewer:OTTMUSP00000040427Re-query CCDS DB by Nucleotide ID:OTTMUST00000076712Re-query CCDS DB by Protein ID:OTTMUSP00000040427
Original member Current member NCBI NM_026792.3 NP_081068.1 Accepted alive Link to Nucleotide Sequence:NM_026792.3Link to Protein Sequence:NP_081068.1Re-query CCDS DB by Nucleotide ID:NM_026792Re-query CCDS DB by Protein ID:NP_081068Link to BLink:NP_081068.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_081068.1 365 Q9D1E8 365 100% 0 0

Chromosomal Locations for CCDS 22126.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 8 (NC_000074.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 8Link to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 18846560 18846778 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 18861477 18861546 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 18868893 18869008 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 18870838 18870927 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 18876040 18876130 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 18878007 18878168 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 18879605 18879728 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 18881738 18881963 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1098 nt):
ATGCTGCTGTCCCTGGTGCTCCACACGTACTCTATGCGCTACCTGCTCCCCAGCGTCCTGTTGCTGGGCT
CG
GCGCCCACCTACCTGCTGGCCTGGACGCTGTGGCGGGTGCTCTCCGCGCTGATGCCCGCCCGCCTGTA
C
CAGCGCGTGGACGACCGGCTTTACTGCGTCTACCAGAACATGGTGCTCTTCTTCTTCGAGAACTACACC
GGG
GTCCAGATATTGCTATATGGAGATTTGCCAAAAAATAAAGAAAATGTAATATATCTAGCGAATCATC
AA
AGCACAGTTGACTGGATTGTTGCGGACATGCTGGCTGCCAGACAGGATGCCCTAGGACATGTGCGCTA
C
GTACTGAAAGACAAGTTAAAATGGCTTCCGCTGTATGGGTTCTACTTTGCTCAGCATGGAGGAATTTAT
GTA
AAACGAAGTGCCAAATTTAATGATAAAGAAATGAGAAGCAAGCTGCAGAGCTATGTGAACGCAGGAA
CA
CCGATGTATCTTGTGATTTTCCCAGAGGGAACAAGGTATAATGCAACATACACAAAACTCCTTTCAGC
C
AGTCAGGCATTTGCTGCTCAGCGGGGCCTTGCAGTATTAAAACACGTACTGACACCAAGAATAAAGGCC
ACT
CACGTTGCTTTTGATTCTATGAAGAGTCATTTAGATGCAATTTATGATGTCACAGTGGTTTATGAAG
GG
AATGAGAAAGGTTCAGGAAAATACTCAAATCCACCATCCATGACTGAGTTTCTCTGCAAACAGTGCCC
A
AAACTTCATATTCACTTTGATCGTATAGACAGAAATGAAGTTCCAGAGGAACAAGAACACATGAAAAAG
TGG
CTTCATGAGCGCTTTGAGATAAAAGATAGGTTGCTCATAGAGTTCTATGATTCACCAGATCCAGAAA
GA
AGAAACAAATTTCCTGGGAAAAGTGTTCATTCCAGACTAAGTGTGAAGAAGACTTTACCTTCAGTGTT
G
ATCTTGGGGAGTTTGACTGCTGTCATGCTGATGACGGAGTCCGGAAGGAAACTGTACATGGGCACCTGG
TTG
TATGGAACCCTCCTTGGCTGCCTGTGGTTTGTTATTAAAGCATAA


Translation (365 aa):
MLLSLVLHTYSMRYLLPSVLLLGSAPTYLLAWTLWRVLSALMPARLYQRVDDRLYCVYQNMVLFFFENYT
G
VQ
ILLYGDLPKNKENVIYLANHQSTVDWIVADMLAARQDALGHVRYVLKDKLKWLPLYGFYFAQHGGIY
V
KRSAKFNDKEMRSKLQSYVNAGTP
MYLVIFPEGTRYNATYTKLLSASQAFAAQRGLAVLKHVLTPRIKA
T
HVAFDSMKSHLDAIYDVTVVYEGNEKGSGKYSNPPSMT
EFLCKQCPKLHIHFDRIDRNEVPEEQEHMKK
W
LHERFEIKD
RLLIEFYDSPDPERRNKFPGKSVHSRLSVKKTLPSVLILGSLTAVMLMTESGRKLYMGTW
L
YGTLLGCLWFVIKA




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser