NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS51085.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
51085.1 Public Mus musculus 3 Lmo4 21 106 86 CCDS HistoryNCBI Gene:16911Re-query CCDS DB by CCDS ID:51085.1Re-query CCDS DB by GeneID:16911See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 51085.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000121796 ENSMUSP00000113513 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000121796Link to Ensembl Protein Viewer:ENSMUSP00000113513Re-query CCDS DB by Nucleotide ID:ENSMUST00000121796Re-query CCDS DB by Protein ID:ENSMUSP00000113513
Original member Current member EBI,WTSI ENSMUST00000120539 ENSMUSP00000113840 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000120539Link to Ensembl Protein Viewer:ENSMUSP00000113840Re-query CCDS DB by Nucleotide ID:ENSMUST00000120539Re-query CCDS DB by Protein ID:ENSMUSP00000113840
Original member Current member EBI,WTSI ENSMUST00000121112 ENSMUSP00000113865 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000121112Link to Ensembl Protein Viewer:ENSMUSP00000113865Re-query CCDS DB by Nucleotide ID:ENSMUST00000121112Re-query CCDS DB by Protein ID:ENSMUSP00000113865
Original member Current member EBI,WTSI OTTMUST00000072133 OTTMUSP00000037059 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000072133Link to Vega Protein Viewer:OTTMUSP00000037059Re-query CCDS DB by Nucleotide ID:OTTMUST00000072133Re-query CCDS DB by Protein ID:OTTMUSP00000037059
Original member Current member EBI,WTSI OTTMUST00000072137 OTTMUSP00000037063 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000072137Link to Vega Protein Viewer:OTTMUSP00000037063Re-query CCDS DB by Nucleotide ID:OTTMUST00000072137Re-query CCDS DB by Protein ID:OTTMUSP00000037063
Original member Current member EBI,WTSI OTTMUST00000072138 OTTMUSP00000037064 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000072138Link to Vega Protein Viewer:OTTMUSP00000037064Re-query CCDS DB by Nucleotide ID:OTTMUST00000072138Re-query CCDS DB by Protein ID:OTTMUSP00000037064
Original member Current member NCBI NM_001161769.1 NP_001155241.1 Accepted alive Link to Nucleotide Sequence:NM_001161769.1Link to Protein Sequence:NP_001155241.1Re-query CCDS DB by Nucleotide ID:NM_001161769Re-query CCDS DB by Protein ID:NP_001155241Link to BLink:NP_001155241.1
Original member Current member NCBI NM_001161770.1 NP_001155242.1 Accepted alive Link to Nucleotide Sequence:NM_001161770.1Link to Protein Sequence:NP_001155242.1Re-query CCDS DB by Nucleotide ID:NM_001161770Re-query CCDS DB by Protein ID:NP_001155242Link to BLink:NP_001155242.1
Original member Current member NCBI NM_010723.3 NP_034853.1 Accepted alive Link to Nucleotide Sequence:NM_010723.3Link to Protein Sequence:NP_034853.1Re-query CCDS DB by Nucleotide ID:NM_010723Re-query CCDS DB by Protein ID:NP_034853Link to BLink:NP_034853.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001155241.1 165 P61969 165 100% 0 0
NP_001155242.1 165 P61969 165 100% 0 0
NP_034853.1 165 P61969 165 100% 0 0

Chromosomal Locations for CCDS 51085.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 3 (NC_000069.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 3Link to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 144189297 144189305 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 144193896 144194051 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 144194407 144194503 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 144201813 144202048 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (498 nt):
ATGGTGAATCCGGGCAGCAGCTCGCAGCCGCCCCCGGTGACGGCCGGCTCCCTCTCCTGGAAGCGCTGCG
CA
GGCTGCGGGGGCAAGATCGCGGACCGCTTTCTGCTCTATGCCATGGACAGCTACTGGCATAGCCGCTG
C
CTCAAGTGCTCCTGCTGCCAGGCGCAGCTGGGCGACATTGGCACGTCCTGTTACACCAAGAGCGGCATG
ATC
CTTTGCAGAAATGACTACATTAGGTTATTTGGGAATAGCGGTGCTTGCAGTGCCTGTGGACAGTCGA
TT
CCTGCAAGTGAGCTCGTCATGAGGGCCCAAGGCAACGTGTATCATCTCAAGTGTTTCACATGTTCTAC
C
TGCCGGAATCGCCTGGTCCCGGGAGATCGGTTTCACTACATCAATGGCAGTTTATTTTGTGAACATGAT
AGA
CCCACAGCCCTCATCAATGGCCATTTGAATTCACTTCAGAGCAATCCACTACTGCCAGACCAGAAGG
TC
TGCTGA


Translation (165 aa):
MVNPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGM
I
LCRNDYI
RLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHD
R
PTALINGHLNSLQSNPLLPDQK
VC



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser