NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS26649.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
26649.1 Public Mus musculus 13 Pcsk1 21 106 86 CCDS HistoryNCBI Gene:18548Re-query CCDS DB by CCDS ID:26649.1Re-query CCDS DB by GeneID:18548See the combined annotation on chromosome 13 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 26649.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000022075 ENSMUSP00000022075 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000022075Link to Ensembl Protein Viewer:ENSMUSP00000022075Re-query CCDS DB by Nucleotide ID:ENSMUST00000022075Re-query CCDS DB by Protein ID:ENSMUSP00000022075
Original member Current member EBI,WTSI OTTMUST00000064311 OTTMUSP00000031918 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000064311Link to Vega Protein Viewer:OTTMUSP00000031918Re-query CCDS DB by Nucleotide ID:OTTMUST00000064311Re-query CCDS DB by Protein ID:OTTMUSP00000031918
Original member Current member NCBI NM_013628.2 NP_038656.1 Accepted alive Link to Nucleotide Sequence:NM_013628.2Link to Protein Sequence:NP_038656.1Re-query CCDS DB by Nucleotide ID:NM_013628Re-query CCDS DB by Protein ID:NP_038656Link to BLink:NP_038656.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_038656.1 753 P63239 753 100% 0 0

Chromosomal Locations for CCDS 26649.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 13 (NC_000079.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 13Link to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13See the combined annotation on chromosome 13 in Sequence Viewer

Chromosome Start Stop Links
13 75090062 75090241 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 75093083 75093187 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 75096290 75096400 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 75097901 75098047 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 75099277 75099353 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 75105951 75106039 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 75110818 75110990 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 75112542 75112754 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 75115237 75115337 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 75125850 75126083 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 75126724 75126881 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 75127810 75127943 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 75130042 75130203 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 75131942 75132319 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2262 nt):
ATGGAGCAAAGAGGTTGGACTCTGCAGTGTACTGCTTTCGCCTTCTTTTGCGTTTGGTGTGCACTAAACA
GT
GTAAAAGCAAAGAGGCAGTTTGTTAATGAATGGGCGGCGGAGATCCCCGGAGGGCAAGAAGCTGCCTC
T
GCCATCGCCGAAGAACTGGGGTATGACCTTTTGGGTCAGATTGGATCACTTGAAAATCACTATTTATTC
AAA
CACAAAAGCCATCCTCGGAGGTCCCGAAGAAGCGCTCTTCATATCACTAAGAGGTTATCTGATGATG
AT
CGTGTGACGTGGGCTGAACAACAGTATGAAAAAGAGAGAAGTAAACGTTCAGTTCAAAAAGACTCAGC
A
TTGGATCTCTTCAATGATCCAATGTGGAATCAGCAGTGGTACTTGCAAGATACCAGAATGACTGCAGCT
CTG
CCCAAGCTGGACCTTCATGTAATACCTGTTTGGGAAAAGGGTATTACTGGCAAAGGAGTTGTTATTA
CT
GTACTGGATGATGGCTTGGAGTGGAATCACACAGACATTTATGCCAATTATGATCCAGAGGCTAGCTA
T
GATTTTAACGATAATGATCATGATCCATTTCCCCGATATGATCTCACAAATGAAAACAAACATGGAACA
AGA
TGTGCAGGTGAAATTGCCATGCAAGCAAATAATCACAAGTGTGGGGTTGGAGTTGCATATAATTCCA
AA
GTTGGAGGCATAAGAATGCTGGATGGCATTGTAACTGATGCCATTGAGGCTAGTTCAATTGGATTCAA
C
CCTGGCCATGTGGATATTTACAGTGCAAGCTGGGGCCCTAATGATGATGGAAAAACTGTGGAGGGGCCT
GGC
AGACTAGCCCAGAAGGCATTTGAATATGGTGTCAAACAGGGGAGACAAGGGAAAGGCTCCATCTTTG
TC
TGGGCTTCAGGGAATGGGGGTCGTCAGGGAGATAACTGTGACTGTGATGGCTACACAGACAGCATTTA
C
ACCATCTCTATCAGCAGTGCCTCCCAGCAAGGCCTGTCACCTTGGTATGCAGAGAAGTGTTCTTCCACA
TTG
GCTACCTCCTACAGCAGTGGTGATTACACAGACCAGCGAATAACAAGCGCTGACCTGCACAATGACT
GC
ACAGAGACCCACACAGGCACCTCGGCTTCAGCACCCCTGGCTGCTGGTATCTTTGCTCTGGCCTTGGA
G
GCAAACCCAAATCTTACCTGGAGAGATATGCAGCATCTGGTTGTCTGGACCTCTGAGTACGACCCATTG
GCC
AGTAACCCAGGTTGGAAAAAGAATGGGGCAGGCTTGATGGTGAACAGCCGATTTGGATTTGGCTTGC
TA
AATGCCAAAGCTCTGGTGGATTTGGCTGATCCTAGGACCTGGAGAAATGTGCCTGAGAAGAAAGAATG
T
GTTGTAAAAGACAATAACTTTGAGCCTAGAGCCCTGAAAGCTAATGGAGAAGTAATTGTTGAAATCCCA
ACA
AGAGCTTGTGAAGGACAAGAAAATGCTATCAAGTCTCTGGAACATGTGCAATTTGAAGCAACAATTG
AA
TATTCTCGTAGAGGAGACCTTCATGTCACACTCACTTCTGCTGTTGGAACCAGCACTGTACTGTTGGC
T
GAAAGGGAAAGAGATACATCCCCCAATGGCTTTAAGAATTGGGACTTCATGTCTGTTCATACATGGGGA
GAG
AATCCTGTAGGCACCTGGACATTGAAAATTACAGACATGTCTGGAAGAATGCAAAATGAAGGAAGGA
TT
GTGAACTGGAAGTTGATTTTGCATGGGACATCTTCTCAACCAGAGCACATGAAGCAGCCTCGTGTGTA
C
ACATCCTACAATACAGTCCAGAATGACAGGAGAGGAGTGGAAAAGATGGTGAATGTTGTGGAGAAGCGG
CCC
ACACAAAAGAGCCTGAATGGCAATCTCCTGGTACCCAAAAACTCCAGCAGCAGCAATGTGGAGGGTA
GA
AGGGATGAGCAGGTACAAGGAACTCCTTCAAAGGCCATGCTGCGACTCCTACAAAGTGCTTTTAGCAA
G
AATGCACTTTCAAAACAATCACCAAAGAAGTCTCCAAGTGCAAAGCTCAGCATCCCTTATGAAAGTTTC
TAT
GAAGCCTTGGAAAAGCTCAACAAGCCCTCCAAGCTTGAAGGCTCTGAAGACAGTCTGTACAGTGACT
AT
GTTGATGTATTCTATAACACAAAACCTTATAAGCATAGAGATGACAGGCTGCTGCAAGCTCTCATGGA
C
ATCCTAAATGAGGAGAATTAA


Translation (753 aa):
MEQRGWTLQCTAFAFFCVWCALNSVKAKRQFVNEWAAEIPGGQEAASAIAEELGYDLLGQIGSLENHYLF
K
HKSHPRRSRRSALHITKRLSDDDR
VTWAEQQYEKERSKRSVQKDSALDLFNDPMWNQQWYLQDTRMTAA
L
PKLDLHVIPVWEKGITGKGVVITVLDDGLEWNHTDIYANY
DPEASYDFNDNDHDPFPRYDLTNENKHGT
R
CAGEIAMQANNHKCGVGVAYNSKVG
GIRMLDGIVTDAIEASSIGFNPGHVDIYSASWGPNDDGKTVEGP
G
RLAQKAFEYGVKQ
GRQGKGSIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSST
L
ATSYSSGDYTDQRI
TSADLHNDCTETHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSEYDPL
A
SNPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPRTWRNVPEKKECVVKDNNFEP
RALKANGEVIVEIP
T
RACEGQENAIKSLEHVQFEATIEYSRRGDLHVTLTSAV
GTSTVLLAERERDTSPNGFKNWDFMSVHTWG
E
NPVGTWTLKITDM
SGRMQNEGRIVNWKLILHGTSSQPEHMKQPRVYTSYNTVQNDRRGVEKMVNVVEKR
P
TQKSLNGNLLVPKNSSSSNVEGRRDEQVQGTPSKAMLRLLQSAFSKNALSKQSPKKSPSAKLSIPYESF
Y
EALEKLNKPSKLEGSEDSLYSDYVDVFYNTKPYKHRDDRLLQALMDILNEEN




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser