NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS19358.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19358.1 Public Mus musculus 5 Srd5a3 21 106 86 CCDS HistoryNCBI Gene:57357Re-query CCDS DB by CCDS ID:19358.1Re-query CCDS DB by GeneID:57357See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 19358.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000031143 ENSMUSP00000031143 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000031143Link to Ensembl Protein Viewer:ENSMUSP00000031143Re-query CCDS DB by Nucleotide ID:ENSMUST00000031143Re-query CCDS DB by Protein ID:ENSMUSP00000031143
Original member Current member EBI,WTSI OTTMUST00000061989 OTTMUSP00000030509 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000061989Link to Vega Protein Viewer:OTTMUSP00000030509Re-query CCDS DB by Nucleotide ID:OTTMUST00000061989Re-query CCDS DB by Protein ID:OTTMUSP00000030509
Original member Current member NCBI NM_020611.4 NP_065636.2 Accepted alive Link to Nucleotide Sequence:NM_020611.4Link to Protein Sequence:NP_065636.2Re-query CCDS DB by Nucleotide ID:NM_020611Re-query CCDS DB by Protein ID:NP_065636Link to BLink:NP_065636.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_065636.2 330 Q9WUP4-1 330 100% 0 0

Chromosomal Locations for CCDS 19358.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 5Link to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 76140328 76140548 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 76147686 76147828 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 76149203 76149238 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 76149753 76149950 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 76153524 76153658 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 76154523 76154782 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (993 nt):
ATGGCTGGGTGGGCCGGGTTTGAGCTCTCGGCCCTGAACCCCCTGCGGACGCTGTGGCTGGCGCTGGCCG
CC
GCCTTCCTGTTCGCGCTGCTGCTGCAGCTGGCGCCCGCCAGGCTGCTGCCGAGCTGCGCGCTCTTCCA
G
GACCTGCTCCGCTACGGGAAGACCAAGCAGTCCGGCTCGCGGCGCCCCGCCGTCTGCAGGGCCTTCGAT
GTC
CCCAAGAGGTACTTTTCTCACTTCTACGTCATCTCAGTTGTGTGGAATGGCTCCCTGCTCTGGCTAC
TT
TCTCAGTCGTTGTTCCTGGGAGCACCTTTTCCAAACTGGCTTAGTGCTCTGCTCAGAACTCTTGGGGC
C
ACACAGTTCCAAGCCCTGGAGATGGAGTCCAAGGCTTCTCGGATGCCAGCGGCTGAGCTGGCTCTGTCT
GCC
TTCTTGGTCTTGGTGTTCCTCTGGGTCCACAGCCTTCGGAGACTCTTTGAGTGCTTCTACGTCAGTG
TC
TTCTCTAATGCAGCCATTCACGTTGTGCAGTACTGTTTCGGGCTTGTCTACTATGTGCTTGTTGGCCT
G
ACTGTACTGAGCCAAGTGCCCATGGATGATAAGAATGTGTATGTTCTGGGGAAGAATCTACTGATACAA
GCC
CGGTGGTTCCACATCCTGGGCATGGTGATGTTCTTCTGGTCATCCGCCCATCAGTATAAATGCCACG
TC
ATCCTCAGCAACCTCAGGAGAAACAAAAAAGGTGTGGTCATCCACTGCCAGCACCGGATCCCCTTTGG
A
GACTGGTTCGAGTACGTGTCTTCAGCTAACTACCTAGCAGAGCTGATGATCTACATCTCCATGGCTGTC
ACC
TTTGGGCTCCACAACTTAACCTGGTGGCTGGTGGTGACGTATGTCTTCTCCAGCCAAGCCTTGTCCG
CA
TTCTTCAACCACAAGTTCTACAGAAGCACATTTGTCTCCTACCCAAAGCATAGGAAAGCGTTCCTCCC
A
TTTTTGTTTTAA


Translation (330 aa):
MAGWAGFELSALNPLRTLWLALAAAFLFALLLQLAPARLLPSCALFQDLLRYGKTKQSGSRRPAVCRAFD
V
PK
RYFSHFYVISVVWNGSLLWLLSQSLFLGAPFPNWLSALLRTLGATQFQALEMESKASRMPAAELALS
A
FLVLVFLWVHSLRRLFECFYVSVFSNAAIHVVQYCFGLVYYVLVGLTVLSQVPMDDKN
VYVLGKNLLIQ
A
RWFHILGMVMFFWSSAHQYKCHVILSNLRRNKK
GVVIHCQHRIPFGDWFEYVSSANYLAELMIYISMAV
T
FGLHNLTWWLVVTYVFSSQALSAFFNHKFYRSTFVSYPKHRKAFLPFLF




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser