NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS16611.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
16611.1 Public Mus musculus 2 Tyro3 21 106 86 CCDS HistoryNCBI Gene:22174Re-query CCDS DB by CCDS ID:16611.1Re-query CCDS DB by GeneID:22174See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 16611.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000028763 ENSMUSP00000028763 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000028763Link to Ensembl Protein Viewer:ENSMUSP00000028763Re-query CCDS DB by Nucleotide ID:ENSMUST00000028763Re-query CCDS DB by Protein ID:ENSMUSP00000028763
Original member Current member EBI,WTSI OTTMUST00000039943 OTTMUSP00000017810 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000039943Link to Vega Protein Viewer:OTTMUSP00000017810Re-query CCDS DB by Nucleotide ID:OTTMUST00000039943Re-query CCDS DB by Protein ID:OTTMUSP00000017810
Original member Current member NCBI NM_019392.2 NP_062265.2 Accepted alive Link to Nucleotide Sequence:NM_019392.2Link to Protein Sequence:NP_062265.2Re-query CCDS DB by Nucleotide ID:NM_019392Re-query CCDS DB by Protein ID:NP_062265Link to BLink:NP_062265.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_062265.2 880 P55144-1 880 100% 0 0

Chromosomal Locations for CCDS 16611.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 2Link to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 119799790 119799883 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 119801548 119801731 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 119802279 119802379 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 119803240 119803410 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 119804768 119804854 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 119805615 119805730 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 119807835 119808012 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 119808733 119808878 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 119809403 119809547 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 119809905 119810034 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 119810117 119810217 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 119810478 119810573 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 119810861 119810941 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 119811598 119811690 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 119812060 119812181 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 119812545 119812654 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 119812803 119812962 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 119813163 119813299 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 119816644 119817034 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2643 nt):
ATGGCGCTGAGGCGGAGCATGGGGTGGCCGGGGCTCCGGCCGCTGCTGCTGGCGGGACTGGCTTCTCTGC
TG
CTCCCCGGGTCTGCGGCCGCAGGCCTGAAGCTCATGGGCGCCCCAGTGAAGATGACCGTGTCTCAGGG
G
CAGCCAGTGAAGCTCAACTGCAGCGTGGAGGGGATGGAGGACCCTGACATCCACTGGATGAAGGATGGC
ACC
GTGGTCCAGAATGCAAGCCAGGTGTCCATCTCCATCAGCGAGCACAGCTGGATTGGCTTACTCAGCC
TA
AAGTCAGTGGAACGGTCTGATGCTGGCCTGTACTGGTGCCAGGTGAAGGATGGGGAGGAAACCAAGAT
T
TCTCAGTCAGTATGGCTCACTGTCGAAGGTGTGCCATTCTTCACAGTGGAACCAAAAGATCTGGCGGTG
CCA
CCCAATGCCCCTTTTCAGCTGTCTTGTGAGGCTGTGGGTCCTCCAGAACCCGTAACCATTTACTGGT
GG
AGAGGACTCACTAAGGTTGGGGGACCTGCTCCCTCTCCCTCTGTTTTAAATGTGACAGGAGTGACCCA
G
CGCACAGAGTTTTCTTGTGAAGCCCGCAACATAAAAGGCCTGGCCACTTCCCGACCAGCCATTGTTCGC
CTT
CAAGCACCGCCTGCAGCTCCTTTCAACACCACAGTAACAACGATCTCCAGCTACAACGCTAGCGTGG
CC
TGGGTGCCAGGTGCTGACGGCCTAGCTCTGCTGCATTCCTGTACTGTACAGGTGGCACACGCCCCAGG
A
GAATGGGAGGCCCTTGCTGTTGTGGTTCCTGTGCCACCTTTTACCTGCCTGCTTCGGAACTTGGCCCCT
GCC
ACCAACTACAGCCTTAGGGTGCGCTGTGCCAATGCCTTGGGCCCTTCTCCCTACGGCGACTGGGTGC
CC
TTTCAGACAAAGGGCCTAGCGCCAGCCAGAGCTCCTCAGAATTTCCATGCCATTCGTACCGACTCAGG
C
CTTATCCTGGAATGGGAAGAAGTGATTCCTGAGGACCCTGGGGAAGGCCCCCTAGGACCTTATAAGCTG
TCC
TGGGTCCAAGAAAATGGAACCCAGGATGAGCTGATGGTGGAAGGGACCAGGGCCAATCTGACCGACT
GG
GATCCCCAGAAGGACCTGATTTTGCGTGTGTGTGCCTCCAATGCAATTGGTGATGGGCCCTGGAGTCA
G
CCACTGGTGGTGTCTTCTCATGACCATGCAGGGAGGCAGGGCCCTCCCCACAGCCGCACATCCTGGGTG
CCT
GTGGTCCTGGGCGTGCTCACCGCCCTGATCACAGCTGCTGCCTTGGCCCTCATCCTGCTTCGGAAGA
GA
CGCAAGGAGACGCGTTTCGGGCAAGCCTTTGACAGTGTCATGGCCCGAGGGGAGCCAGCTGTACACTT
C
CGGGCAGCCCGATCTTTCAATCGAGAAAGGCCTGAACGCATTGAGGCCACATTGGATAGCCTGGGCATC
AGC
GATGAATTGAAGGAAAAGCTGGAGGATGTCCTCATTCCAGAGCAGCAGTTCACCCTCGGTCGGATGT
TG
GGCAAAGGAGAGTTTGGATCAGTGCGGGAAGCCCAGCTAAAGCAGGAAGATGGCTCCTTCGTGAAAGT
G
GCAGTGAAGATGCTGAAAGCTGACATCATTGCCTCAAGCGACATAGAAGAGTTCCTCCGGGAAGCAGCT
TGC
ATGAAGGAGTTTGACCATCCACACGTGGCCAAGCTTGTTGGGGTGAGCCTCCGGAGCAGGGCTAAAG
GT
CGTCTCCCCATTCCCATGGTCATCCTGCCCTTCATGAAACATGGAGACTTGCACGCCTTTCTGCTCGC
C
TCCCGAATCGGGGAGAACCCTTTTAACCTGCCCCTCCAGACCCTGGTCCGGTTCATGGTGGACATTGCC
TGT
GGCATGGAGTACCTGAGCTCCCGGAACTTCATCCACCGAGACCTAGCAGCTCGGAATTGCATGCTGG
CC
GAGGACATGACAGTGTGTGTGGCTGATTTTGGACTCTCTCGGAAAATCTATAGCGGGGACTATTATCG
T
CAGGGCTGTGCCTCCAAATTGCCCGTCAAGTGGCTGGCCCTGGAGAGCTTGGCTGACAACTTGTATACT
GTA
CACAGTGATGTGTGGGCCTTCGGGGTGACCATGTGGGAGATCATGACTCGTGGGCAGACGCCATATG
CT
GGCATTGAAAATGCCGAGATTTACAACTACCTCATCGGCGGGAACCGCCTGAAGCAGCCTCCGGAGTG
C
ATGGAGGAAGTGTATGATCTCATGTACCAGTGCTGGAGCGCCGACCCCAAGCAGCGCCCAAGCTTCACG
TGT
CTGCGAATGGAACTGGAGAACATTCTGGGCCACCTGTCTGTGCTGTCCACCAGCCAGGACCCCTTGT
AC
ATCAACATTGAGAGAGCTGAGCAGCCTACTGAGAGTGGCAGCCCTGAGGTCCACTGTGGAGAGCGATC
C
AGCAGCGAGGCAGGGGACGGCAGTGGCGTGGGGGCAGTAGGTGGCATCCCCAGTGACTCTCGGTACATC
TTC
AGCCCCGGAGGGCTATCCGAGTCACCAGGGCAGCTGGAGCAGCAGCCAGAAAGCCCCCTCAATGAGA
AC
CAGAGGCTGTTGTTGCTGCAGCAAGGGCTACTGCCTCACAGTAGCTGTTAA


Translation (880 aa):
MALRRSMGWPGLRPLLLAGLASLLLPGSAAAGLKLMGAPVKMTVSQGQPVKLNCSVEGMEDPDIHWMKDG
T
VVQNASQVSISISEHSWIGLL
SLKSVERSDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAV
P
PNAPFQLSCEAVGPPEPVTIYWWRGLTKVGGPAPSPSVLNVT
GVTQRTEFSCEARNIKGLATSRPAIVR
L
Q
APPAAPFNTTVTTISSYNASVAWVPGADGLALLHSCTVQVAHAPGEWEALAVVVPVPPFTCLLRNLAP
A
TNYSLRVRCANALGPSPYGDWVPFQTKGL
APARAPQNFHAIRTDSGLILEWEEVIPEDPGEGPLGPYKL
S
WVQENGTQ
DELMVEGTRANLTDWDPQKDLILRVCASNAIGDGPWSQPLVVSSHDHAGRQGPPHSRTSWV
P
VVLGVLTALITAAALALILLRKRRKETRF
GQAFDSVMARGEPAVHFRAARSFNRERPERIEATLDSLGI
S
DELKEKLEDVLIPEQQFTLGRMLGK
GEFGSVREAQLKQEDGSFVKVAVKMLKADIIASSDIEEFLREAA
C
MKEFDHPHVAKLV
GVSLRSRAKGRLPIPMVILPFMKHGDLHAFLLASRIGENPFNLPLQTLVRFMVDIA
C
GMEYLSSRNFIHRDLAARNC
MLAEDMTVCVADFGLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYT
V
HSDV
WAFGVTMWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEEVYDLMYQCWSADPKQRPSFT
C
LRMELENILGHLSVLSTSQDPLYINIERAEQPTESGSPEVHCGERSSSEAGDGSGVGAVGGIPSDSRYI
F
SPGGLSESPGQLEQQPESPLNENQRLLLLQQGLLPHSSC




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser