NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS15136.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
15136.1 Public Mus musculus 1 Atg16l1 21 106 86 CCDS HistoryNCBI Gene:77040Re-query CCDS DB by CCDS ID:15136.1Re-query CCDS DB by GeneID:77040See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 15136.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000027512 ENSMUSP00000027512 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000027512Link to Ensembl Protein Viewer:ENSMUSP00000027512Re-query CCDS DB by Nucleotide ID:ENSMUST00000027512Re-query CCDS DB by Protein ID:ENSMUSP00000027512
Original member Current member EBI,WTSI OTTMUST00000039677 OTTMUSP00000017708 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000039677Link to Vega Protein Viewer:OTTMUSP00000017708Re-query CCDS DB by Nucleotide ID:OTTMUST00000039677Re-query CCDS DB by Protein ID:OTTMUSP00000017708
Original member Current member NCBI NM_029846.4 NP_084122.2 Accepted alive Link to Nucleotide Sequence:NM_029846.4Link to Protein Sequence:NP_084122.2Re-query CCDS DB by Nucleotide ID:NM_029846Re-query CCDS DB by Protein ID:NP_084122Link to BLAST:NP_084122.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_084122.2 607 Q8C0J2-1 607 100% 0 0

Chromosomal Locations for CCDS 15136.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 87756200 87756314 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87760051 87760144 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87765338 87765443 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87766109 87766182 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87766806 87767057 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87771392 87771457 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87774145 87774231 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87774813 87774869 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87775757 87775859 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87778922 87779027 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87780125 87780195 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87781671 87781742 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87785876 87785996 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87786241 87786346 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87789331 87789480 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87789572 87789619 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87790586 87790687 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 87791216 87791309 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1824 nt):
ATGTCGTCGGGCCTGCGCGCCGCAGACTTTCCCCGCTGGAAGCGTCACATCGCGGAGGAACTGAGGCGCC
GG
GACCGACTGCAGAGGCAGGCGTTCGAGGAGATCATTCTGCAGTATACCAAGTTGCTGGAAAAGTCAGA
T
CTTCATTCAGTATTGACCCAGAAACTACAAGCAGAAAAGCATGACATGCCAAATAGGCATGAAATAAGT
CCT
GGACATGATGGTGCGTGGAATGATAGTCAACTACAAGAAATGGCCCAGTTGAGGATCAAACACCAGG
AA
GAGCTGACCGAACTGCACAAGAAGCGTGGGGAGTTAGCTCAGTTGGTGATTGACCTGAACAACCAAAT
G
CAGCAGAAGGACAAGGAGATACAGATGAATGAAGCAAAGATTTCGGAGTATTTACAGACCATCTCTGAC
CTG
GAGACAAACTGCCTGGACCTGCGCACCAAACTGCAGGACCTCGAGGTAGCCAACCAGACCCTGAAGG
AT
GAGTATGACGCCCTGCAGATTACTTTTACTGCCCTAGAAGAGAAACTGAGGAAAACTACTGAGGAGAA
C
CAGGAACTGGTCACCAGATGGATGGCTGAGAAGGCCCAAGAAGCCAATCGCCTCAATGCAGAGAATGAG
AAG
GACTCCAGGAGGCGTCAAGCACGGCTGCAGAAGGAGCTTGCAGAAGCAGCAAAGGAACCTCTACCTG
TT
GAACAGGATGATGACATTGAAGTCATTGTGGATGAGACCTCAGACCACACAGAAGAGACCTCTCCCGT
C
CGAGCTGTCAGCAGAGCAGCTACTAAGCGACTCTCGCAGCCTGCTGGAGGCCTTCTGGATTCTATCACT
AAT
ATCTTTGGGAGACGCTCTGTCTCTTCCATCCCAGTCCCCCAGGATATCATGGACACTCATCCTGCTT
CT
GGTAAAGATGTGAGAGTCCCAACTACTGCCTCGTATGTCTTCGATGCGCATGACGGAGAGGTCAACGC
A
GTGCAGTTCAGTCCAGGCTCCCGGTTGCTGGCCACTGGAGGCATGGACCGCAGGGTGAAACTTTGGGAA
GCA
TTCGGAGATAAATGTGAATTCAAGGGCTCCCTGTCTGGCAGTAATGCTGGAATTACAAGCATTGAAT
TT
GATAGTGCTGGAGCTTACCTATTAGCAGCTTCAAATGATTTTGCAAGCCGAATCTGGACTGTGGATGA
T
TATCGATTACGGCACACACTCACAGGCCACAGCGGGAAAGTCCTCTCTGCCAAGTTCCTGCTGGACAAT
GCA
CGGATTGTCTCAGGAAGTCACGACCGGACCCTCAAACTCTGGGATCTCCGCAGCAAAGTCTGCATAA
AA
ACAGTGTTTGCAGGATCCAGCTGCAATGACATTGTTTGCACTGAACAATGTGTAATGAGTGGACATTT
T
GACAAGAAAATTCGTTTCTGGGATATCCGGTCAGAGAGTGTGGTCCGAGAGATGGAACTGTTAGGGAAG
ATC
ACTGCTCTGGACCTAAACCCTGAGAGAACTGAGCTCCTGAGCTGCTCCCGTGATGACCTGCTAAAAG
TC
ATCGACCTCCGGACAAATGCAGTCAAACAGACATTCAGTGCGCCTGGATTCAAATGCGGCTCTGACTG
G
ACCCGGGTTGTCTTCAGCCCTGATGGCAGTTACGTGGCAGCAGGCTCAGCCGAGGGTTCTCTTTATGTC
TGG
AGTGTGCTGACAGGGAAAGTGGAGAAGGTTCTTTCAAAACAGCACAGCTCTTCTATCAATGCGGTGG
CG
TGGGCCCCCTCGGGCTTACATGTTGTCAGTGTGGACAAAGGAAGCAGAGCTGTGCTGTGGGCACAGCC
T
TGA


Translation (607 aa):
MSSGLRAADFPRWKRHIAEELRRRDRLQRQAFEEIILQYTKLLEKSDLHSVLTQKLQAEKHDMPNRHEIS
P
GHDGAWNDSQLQEMAQLRIKHQEELTELHKKRGE
LAQLVIDLNNQMQQKDKEIQMNEAKISEYLQTISD
L
ETNCLDLRTKLQDLEVANQTLKDEYDALQITFTALEEKLRKTTEENQELVTRWMAEKAQEANRLNAENE
K
DS
RRRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAVSRAATKRLSQPAGGLLDSIT
N
IF
GRRSVSSIPVPQDIMDTHPASGKDVRVPTTASYVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWE
A
FG
DKCEFKGSLSGSNAGITSIEFDSAGAYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDN
A
RIVSGSHDRTLKLWDLRSKV
CIKTVFAGSSCNDIVCTEQCVMSGHFDKKIRFWDIRSESVVREMELLGK
I
TALDLNPERTELLSCSRDDLLKVIDLRTNAVKQTF
SAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYV
W
SVLTGKVEKVLSKQH
SSSINAVAWAPSGLHVVSVDKGSRAVLWAQP



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser