NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS36304.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
36304.1 Public Mus musculus 11 Rara 19 105 81 CCDS HistoryNCBI Gene:19401Re-query CCDS DB by CCDS ID:36304.1Re-query CCDS DB by GeneID:19401See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 36304.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000068133 ENSMUSP00000069744 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000068133Link to Ensembl Protein Viewer:ENSMUSP00000069744Re-query CCDS DB by Nucleotide ID:ENSMUST00000068133Re-query CCDS DB by Protein ID:ENSMUSP00000069744
Original member Current member EBI,WTSI ENSMUST00000107474 ENSMUSP00000103098 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000107474Link to Ensembl Protein Viewer:ENSMUSP00000103098Re-query CCDS DB by Nucleotide ID:ENSMUST00000107474Re-query CCDS DB by Protein ID:ENSMUSP00000103098
Original member Current member EBI,WTSI ENSMUST00000107475 ENSMUSP00000103099 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000107475Link to Ensembl Protein Viewer:ENSMUSP00000103099Re-query CCDS DB by Nucleotide ID:ENSMUST00000107475Re-query CCDS DB by Protein ID:ENSMUSP00000103099
Original member Current member EBI,WTSI ENSMUST00000164748 ENSMUSP00000129791 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000164748Link to Ensembl Protein Viewer:ENSMUSP00000129791Re-query CCDS DB by Nucleotide ID:ENSMUST00000164748Re-query CCDS DB by Protein ID:ENSMUSP00000129791
Original member Current member EBI,WTSI OTTMUST00000014706 OTTMUSP00000006834 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000014706Link to Vega Protein Viewer:OTTMUSP00000006834Re-query CCDS DB by Nucleotide ID:OTTMUST00000014706Re-query CCDS DB by Protein ID:OTTMUSP00000006834
Original member Current member EBI,WTSI OTTMUST00000014707 OTTMUSP00000006835 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000014707Link to Vega Protein Viewer:OTTMUSP00000006835Re-query CCDS DB by Nucleotide ID:OTTMUST00000014707Re-query CCDS DB by Protein ID:OTTMUSP00000006835
Original member Current member EBI,WTSI OTTMUST00000014708 OTTMUSP00000006836 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000014708Link to Vega Protein Viewer:OTTMUSP00000006836Re-query CCDS DB by Nucleotide ID:OTTMUST00000014708Re-query CCDS DB by Protein ID:OTTMUSP00000006836
Original member Current member NCBI NM_001177302.1 NP_001170773.1 Accepted alive Link to Nucleotide Sequence:NM_001177302.1Link to Protein Sequence:NP_001170773.1Re-query CCDS DB by Nucleotide ID:NM_001177302Re-query CCDS DB by Protein ID:NP_001170773Link to BLink:NP_001170773.1
Original member Current member NCBI NM_001177303.1 NP_001170774.1 Accepted alive Link to Nucleotide Sequence:NM_001177303.1Link to Protein Sequence:NP_001170774.1Re-query CCDS DB by Nucleotide ID:NM_001177303Re-query CCDS DB by Protein ID:NP_001170774Link to BLink:NP_001170774.1
Original member Current member NCBI NM_009024.2 NP_033050.2 Accepted alive Link to Nucleotide Sequence:NM_009024.2Link to Protein Sequence:NP_033050.2Re-query CCDS DB by Nucleotide ID:NM_009024Re-query CCDS DB by Protein ID:NP_033050Link to BLink:NP_033050.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001170773.1 462 P11416-1 462 100% 0 0
NP_001170774.1 462 P11416-1 462 100% 0 0
NP_033050.2 462 P11416-1 462 100% 0 0

Chromosomal Locations for CCDS 36304.1

Assembly GRCm38.p3 (GCF_000001635.23)

On '+' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 11Link to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 98950618 98950795 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 98966347 98966495 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 98968045 98968186 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 98970157 98970317 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 98970493 98970669 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 98971582 98971786 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 98972512 98972670 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 98973420 98973637 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1389 nt):
ATGGCCAGCAATAGCAGTTCCTGCCCAACACCTGGGGGCGGGCACCTCAATGGGTACCCAGTACCCCCCT
AC
GCCTTCTTCTTTCCCCCTATGCTGGGTGGACTCTCCCCACCCGGCGCTCTCACCAGCCTCCAGCACCA
G
CTTCCAGTCAGTGGTTACAGCACACCGTCCCCAGCCACCATCGAGACCCAGAGCAGCAGTTCCGAAGAG
ATA
GTACCCAGCCCTCCCTCACCACCGCCCCTGCCCCGCATCTACAAGCCTTGCTTTGTTTGTCAAGACA
AA
TCATCCGGCTACCACTATGGGGTCAGCGCCTGTGAGGGCTGTAAGGGCTTCTTCCGACGAAGCATCCA
G
AAGAACATGGTGTATACGTGTCACCGGGACAAGAACTGCATCATCAACAAGGTGACCCGGAACCGCTGC
CAG
TACTGCCGGCTGCAGAAATGTTTCGACGTGGGCATGTCCAAGGAGTCGGTGCGAAACGATCGAAACA
AA
AAGAAGAAAGAGGCACCCAAGCCCGAGTGCTCAGAGAGCTACACGCTGACGCCTGAGGTGGGCGAGCT
C
ATTGAGAAGGTTCGCAAAGCGCACCAGGAGACCTTCCCGGCCCTCTGCCAGCTGGGCAAGTACACTACG
AAC
AACAGCTCAGAACAACGAGTCTCCCTGGACATTGACCTCTGGGACAAGTTCAGTGAACTCTCCACCA
AG
TGCATCATTAAGACTGTGGAGTTCGCCAAGCAGCTTCCCGGCTTCACCACCCTCACCATCGCCGACCA
G
ATCACCCTCCTCAAGGCTGCCTGCCTGGATATCCTGATTCTGCGAATCTGCACGCGGTACACGCCTGAG
CAA
GACACAATGACCTTCTCAGATGGACTGACCCTGAACCGGACTCAGATGCACAACGCTGGCTTTGGCC
CC
CTCACCGACTTGGTCTTTGCCTTCGCCAACCAGCTGCTGCCCCTGGAGATGGACGATGCTGAGACTGG
A
CTGCTCAGTGCCATCTGCCTCATCTGTGGAGACCGACAGGACCTGGAGCAGCCAGACAAGGTGGACATG
CTG
CAAGAGCCGCTGCTGGAAGCACTGAAAGTCTACGTCCGGAAACGGAGGCCCAGCCGACCCCACATGT
TC
CCCAAGATGCTGATGAAGATCACAGACCTTCGGAGCATCAGCGCCAAGGGAGCTGAACGGGTGATCAC
A
TTGAAGATGGAGATCCCAGGCTCCATGCCACCGCTGATCCAGGAAATGCTGGAGAACTCTGAGGGCTTG
GAC
ACTCTAAGCGGACAGTCGGGGGGCGGAACACGAGATGGGGGTGGCCTGGCCCCCCCTCCGGGTAGCT
GT
AGCCCCAGCCTCAGTCCCAGCTCCCACAGAAGCAGCCCAGCCACCCAATCCCCATGA


Translation (462 aa):
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTSLQHQLPVSGYSTPSPATIETQSSSSEE
I
VPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCK
GFFRRSIQKNMVYTCHRDKNCIINKVTRNRC
Q
YCRLQKCFDVGMSKE
SVRNDRNKKKKEAPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTT
N
NSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDIL
ILRICTRYTPE
Q
DTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICG
DRQDLEQPDKVDM
L
QEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAK
GAERVITLKMEIPGSMPPLIQEMLENSEGL
D
TLSGQSGGGTRDGGGLAPPPGSCSPSLSPSSHRSSPATQSP




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser