NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS56765.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
56765.1 Public Mus musculus 11 Npm1 21 106 86 CCDS HistoryNCBI Gene:18148Re-query CCDS DB by CCDS ID:56765.1Re-query CCDS DB by GeneID:18148See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 10, NCBI annotation release 38.1, Ensembl annotation release 68

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 56765.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000109354 ENSMUSP00000104978 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000109354Link to Ensembl Protein Viewer:ENSMUSP00000104978Re-query CCDS DB by Nucleotide ID:ENSMUST00000109354Re-query CCDS DB by Protein ID:ENSMUSP00000104978
Original member Current member EBI,WTSI OTTMUST00000012026 OTTMUSP00000005573 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000012026Link to Vega Protein Viewer:OTTMUSP00000005573Re-query CCDS DB by Nucleotide ID:OTTMUST00000012026Re-query CCDS DB by Protein ID:OTTMUSP00000005573
Original member Current member NCBI NM_001252261.1 NP_001239190.1 Accepted alive Link to Nucleotide Sequence:NM_001252261.1Link to Protein Sequence:NP_001239190.1Re-query CCDS DB by Nucleotide ID:NM_001252261Re-query CCDS DB by Protein ID:NP_001239190Link to BLink:NP_001239190.1

Chromosomal Locations for CCDS 56765.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 11Link to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 33155212 33155220 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 33156003 33156104 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 33156664 33156747 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 33156991 33157048 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 33159934 33159995 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 33160334 33160440 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 33160828 33160921 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 33161106 33161225 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 33161548 33161627 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 33162922 33162979 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (774 nt):
ATGGAAGACTCGATGGATATGGACATGAGTCCTCTTAGGCCTCAGAACTACCTTTTCGGCTGTGAACTAA
AG
GCTGACAAAGACTATCACTTTAAAGTGGATAATGATGAAAATGAGCACCAGTTGTCATTAAGAACGGT
C
AGTTTAGGAGCAGGGGCAAAAGATGAGTTACACATCGTAGAGGCAGAAGCAATGAACTATGAAGGCAGT
CCA
ATTAAAGTAACACTGGCAACTTTGAAAATGTCTGTACAACCAACAGTTTCCCTAGGGGGCTTTGAAA
TT
ACACCACCTGTGGTCTTACGGTTGAAGTGTGGTTCAGGGCCTGTGCACATTAGTGGACAGCATCTAGT
A
GCTGTAGAGGAAGATGCAGAGTCTGAAGATGAAGATGAGGAGGACGTAAAACTCTTAGGCATGTCTGGA
AAG
CGATCTGCTCCTGGAGGTGGTAACAAGGTTCCACAGAAAAAAGTAAAACTTGATGAAGATGATGAGG
AC
GATGATGAGGACGATGAGGATGATGAGGATGATGATGATGATGATTTTGATGAAGAGGAAACTGAAGA
A
AAGGTCCCAGTGAAGAAATCTGTACGAGATACCCCAGCCAAAAATGCACAAAAATCAAACCAAAATGGA
AAA
GACTTAAAACCATCAACACCGAGATCAAAGGGTCAAGAGTCCTTCAAAAAACAGGAAAAGACTCCTA
AA
ACACCAAAAGGACCTAGTTCTGTAGAAGACATTAAGGCAAAAATGCAAGCAAGTATAGAAAAAGCGCA
T
TGA


Translation (257 aa):
MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGS
P
IKVTLATLKMSVQPT
VSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSG
K
RSAPGGGNKVPQ
KKVKLDEDDEDDDEDDEDDEDDDDDDFDEEETEEKVPVKKSVRDTPAKNAQKSNQNG
K
DLKPSTPRSK
GQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKAH



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser