NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS35592.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
35592.1 Public Mus musculus 1 Nrp2 21 106 86 CCDS HistoryNCBI Gene:18187Re-query CCDS DB by CCDS ID:35592.1Re-query CCDS DB by GeneID:18187See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 35592.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000027112 ENSMUSP00000027112 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000027112Link to Ensembl Protein Viewer:ENSMUSP00000027112Re-query CCDS DB by Nucleotide ID:ENSMUST00000027112Re-query CCDS DB by Protein ID:ENSMUSP00000027112
Original member Current member EBI,WTSI OTTMUST00000005002 OTTMUSP00000002411 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000005002Link to Vega Protein Viewer:OTTMUSP00000002411Re-query CCDS DB by Nucleotide ID:OTTMUST00000005002Re-query CCDS DB by Protein ID:OTTMUSP00000002411
Original member Current member NCBI NM_001077406.1 NP_001070874.1 Accepted alive Link to Nucleotide Sequence:NM_001077406.1Link to Protein Sequence:NP_001070874.1Re-query CCDS DB by Nucleotide ID:NM_001077406Re-query CCDS DB by Protein ID:NP_001070874Link to BLink:NP_001070874.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001070874.1 906 O35375-6 906 100% 0 0

Chromosomal Locations for CCDS 35592.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 1Link to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 62704205 62704277 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 62718930 62719107 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 62738289 62738470 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 62744175 62744405 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 62745358 62745513 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 62747158 62747327 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 62749133 62749288 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 62760775 62760919 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 62762691 62763040 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 62764850 62764994 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 62769000 62769116 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 62771705 62771845 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 62783294 62783556 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 62785045 62785141 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 62786281 62786316 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 62795709 62795989 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2721 nt):
ATGGATATGTTTCCTCTTACCTGGGTTTTCTTAGCTCTGTACTTTTCAGGACACGAAGTGAGAAGCCAGC
AA
GATCCACCCTGCGGAGGTCGGCTGAATTCCAAAGATGCTGGCTACATCACTTCCCCAGGCTACCCCCA
G
GACTATCCCTCCCACCAGAACTGTGAGTGGATTGTCTACGCCCCCGAACCCAACCAGAAGATTGTTCTC
AAC
TTCAACCCTCACTTTGAAATCGAGAAACACGACTGCAAGTATGACTTCATTGAGATTCGGGATGGGG
AC
AGTGAGTCAGCTGACCTCCTGGGCAAGCACTGTGGGAACATCGCCCCGCCCACCATCATCTCCTCAGG
C
TCCGTGTTATACATCAAGTTCACCTCAGACTACGCCCGGCAGGGGGCAGGTTTCTCTCTACGCTATGAG
ATC
TTCAAAACAGGCTCTGAAGATTGTTCCAAGAACTTTACAAGCCCCAATGGGACCATTGAATCTCCAG
GG
TTTCCAGAGAAGTATCCACACAATCTGGACTGTACCTTCACCATCCTGGCCAAACCCAGGATGGAGAT
C
ATCCTACAGTTCCTGACCTTTGACCTGGAGCATGACCCTCTACAAGTGGGGGAAGGAGACTGTAAATAT
GAC
TGGCTGGACATCTGGGATGGCATTCCACATGTTGGACCTCTGATTGGCAAGTACTGTGGGACGAAAA
CA
CCCTCCAAACTCCGCTCGTCCACGGGGATCCTCTCCTTGACCTTTCACACGGACATGGCAGTGGCCAA
G
GATGGCTTCTCCGCACGTTACTATTTGATCCACCAGGAGCCACCTGAGAATTTTCAGTGCAATGTCCCT
TTG
GGAATGGAGTCTGGCCGGATTGCTAATGAACAGATCAGTGCCTCCTCCACCTTCTCTGATGGGAGGT
GG
ACTCCTCAACAGAGCCGGCTCCATGGTGATGACAATGGCTGGACACCCAATTTGGATTCCAACAAGGA
G
TATCTCCAGGTGGACCTGCGCTTCCTAACCATGCTCACAGCCATTGCAACACAGGGAGCCATTTCCAGG
GAA
ACCCAGAAAGGCTACTACGTCAAATCGTACAAGCTGGAAGTCAGCACAAATGGTGAAGATTGGATGG
TC
TACCGGCATGGCAAAAACCACAAGATATTCCAAGCGAACAATGATGCGACCGAGGTGGTGCTAAACAA
G
CTCCACATGCCACTGCTGACTCGGTTCATCAGGATCCGCCCGCAGACGTGGCATTTGGGCATTGCCCTT
CGC
CTGGAGCTCTTTGGCTGCCGGGTCACAGATGCACCCTGCTCCAACATGCTGGGGATGCTCTCGGGCC
TC
ATTGCTGATACCCAGATCTCTGCCTCCTCCACCCGAGAGTACCTCTGGAGCCCCAGTGCTGCCCGCCT
G
GTTAGTAGCCGCTCTGGCTGGTTTCCTCGGAACCCTCAAGCCCAGCCAGGTGAAGAATGGCTTCAGGTA
GAC
CTGGGGACACCCAAGACAGTGAAAGGGGTCATCATCCAGGGAGCCCGAGGAGGAGACAGCATCACTG
CC
GTGGAAGCCAGGGCGTTTGTACGCAAGTTCAAAGTCTCCTACAGCCTAAATGGCAAGGACTGGGAATA
T
ATCCAGGACCCCAGGACTCAGCAGACAAAGCTGTTTGAAGGGAACATGCACTATGACACCCCTGACATC
CGA
AGGTTCGATCCTGTTCCAGCGCAGTATGTGCGGGTGTACCCAGAGAGGTGGTCGCCAGCAGGCATCG
GG
ATGAGGCTGGAGGTGCTGGGCTGTGACTGGACAGACTCAAAGCCCACAGTGGAGACGCTGGGACCCAC
C
GTGAAGAGTGAAGAGACTACCACCCCATATCCCATGGATGAGGATGCCACCGAGTGTGGGGAAAACTGC
AGC
TTTGAGGATGACAAAGATTTGCAACTTCCTTCAGGATTCAACTGCAACTTTGATTTTCCGGAAGAGA
CC
TGTGGTTGGGTGTACGACCATGCCAAGTGGCTCCGGAGCACGTGGATCAGCAGCGCTAACCCCAATGA
C
AGAACATTTCCAGATGACAAGAACTTCTTGAAACTGCAGAGTGATGGCCGACGAGAGGGCCAGTACGGG
CGG
CTCATCAGCCCACCGGTGCACCTGCCCCGAAGCCCTGTGTGCATGGAGTTCCAGTACCAAGCCATGG
GC
GGCCACGGGGTGGCACTGCAGGTGGTTCGGGAAGCCAGCCAGGAAAGCAAACTCCTTTGGGTCATCCG
T
GAGGACCAGGGCAGCGAGTGGAAGCACGGGCGCATTATCCTGCCCAGCTATGACATGGAGTATCAGATC
GTG
TTCGAGGGAGTGATAGGGAAGGGACGATCGGGAGAGATTTCCATCGATGACATTCGGATAAGCACTG
AT
GTCCCACTGGAGAACTGCATGGAACCCATATCAGCTTTTGCAGGTGAGGATTTTAAAGGGGGCACCCT
C
CCGCCAGGGACCGAGCCCACAGTGGACACGGTGCCCGTGCAGCCCATCCCAGCCTACTGGTATTACGTT
ATG
GCGGCCGGGGGCGCCGTGCTGGTGCTGGCCTCCGTCGTCCTGGCCCTGGTGCTCCACTACCACCGGT
TC
CGCTATGCGGCCAAGAAGACCGATCACTCCATCACCTACAAAACCTCCCACTACACCAACGGGGCCCC
T
CTGGCGGTCGAGCCCACCCTAACCATTAAGCTAGAGCAAGAGCGGGGCTCGCACTGCTGA


Translation (906 aa):
MDMFPLTWVFLALYFSGHEVRSQQDPPCGGRLNSKDAGYITSPGYPQDYPSHQNCEWIVYAPEPNQKIVL
N
FNPHFEIEKHDC
KYDFIEIRDGDSESADLLGKHCGNIAPPTIISSGSVLYIKFTSDYARQGAGFSLRYE
I
FKT
GSEDCSKNFTSPNGTIESPGFPEKYPHNLDCTFTILAKPRMEIILQFLTFDLEHDPLQVGEGDCKY
D
WLDIWDGIPH
VGPLIGKYCGTKTPSKLRSSTGILSLTFHTDMAVAKDGFSARYYLIHQEPPENFQCNVP
L
GMESGRIANEQISASSTFSDGRWTPQQSRLHGDDNGWTPNLDSNKEYLQ
VDLRFLTMLTAIATQGAISR
E
TQKGYYVKSYKLEVSTNGEDWMVYRHGKNHK
IFQANNDATEVVLNKLHMPLLTRFIRIRPQTWHLGIAL
R
LELFGCRVT
DAPCSNMLGMLSGLIADTQISASSTREYLWSPSAARLVSSRSGWFPRNPQAQPGEEWLQV
D
LGTPKTVKGVIIQGARGGDSITAVEARAFVRKFKVSYSLNGKDWEYIQDPRTQQTK
LFEGNMHYDTPDI
R
RFDPVPAQYVRVYPERWSPAGIGMRLEVLGCDWT
DSKPTVETLGPTVKSEETTTPYPMDEDATECGENC
S
FED
DKDLQLPSGFNCNFDFPEETCGWVYDHAKWLRSTWISSANPNDRTFPDDKNFLKLQSDGRREGQYG
R
LISPPVHLPRSPVCMEFQYQAMGGHGVALQVVREASQESKLLWVIREDQGSEWKHGRIILPSYDMEYQ
I
V
FEGVIGKGRSGEISIDDIRISTDVPLENCM
EPISAFAGEDFKGGTLPPGTEPTVDTVPVQPIPAYWYYV
M
AAGGAVLVLASVVLALVLHYHRFRYAAKKTDHSITYKTSHYTNGAPLAVEPTLTIKLEQERGSHC




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser