NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS6777.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
6777.1 Public Homo sapiens 9 LPAR1 20 108 85 CCDS HistoryNCBI Gene:1902Re-query CCDS DB by CCDS ID:6777.1Re-query CCDS DB by GeneID:1902See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 6777.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000358883 ENSP00000351755 Accepted alive Link to Ensembl Transcript Viewer:ENST00000358883Link to Ensembl Protein Viewer:ENSP00000351755Re-query CCDS DB by Nucleotide ID:ENST00000358883Re-query CCDS DB by Protein ID:ENSP00000351755
Original member Current member EBI,WTSI ENST00000374430 ENSP00000363552 Accepted alive Link to Ensembl Transcript Viewer:ENST00000374430Link to Ensembl Protein Viewer:ENSP00000363552Re-query CCDS DB by Nucleotide ID:ENST00000374430Re-query CCDS DB by Protein ID:ENSP00000363552
Original member Current member EBI,WTSI ENST00000374431 ENSP00000363553 Accepted alive Link to Ensembl Transcript Viewer:ENST00000374431Link to Ensembl Protein Viewer:ENSP00000363553Re-query CCDS DB by Nucleotide ID:ENST00000374431Re-query CCDS DB by Protein ID:ENSP00000363553
Original member Current member EBI,WTSI OTTHUMT00000053631 OTTHUMP00000021903 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000053631Link to Vega Protein Viewer:OTTHUMP00000021903Re-query CCDS DB by Nucleotide ID:OTTHUMT00000053631Re-query CCDS DB by Protein ID:OTTHUMP00000021903
Original member Current member EBI,WTSI OTTHUMT00000053632 OTTHUMP00000021904 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000053632Link to Vega Protein Viewer:OTTHUMP00000021904Re-query CCDS DB by Nucleotide ID:OTTHUMT00000053632Re-query CCDS DB by Protein ID:OTTHUMP00000021904
Original member Current member EBI,WTSI OTTHUMT00000053633 OTTHUMP00000021905 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000053633Link to Vega Protein Viewer:OTTHUMP00000021905Re-query CCDS DB by Nucleotide ID:OTTHUMT00000053633Re-query CCDS DB by Protein ID:OTTHUMP00000021905
Original member NCBI NM_001401.3 NP_001392.2 Updated not alive Link to Nucleotide Sequence:NM_001401.3Link to Protein Sequence:NP_001392.2Re-query CCDS DB by Nucleotide ID:NM_001401Re-query CCDS DB by Protein ID:NP_001392
Current member NCBI NM_001401.4 NP_001392.2 Accepted alive Link to Nucleotide Sequence:NM_001401.4Link to Protein Sequence:NP_001392.2Re-query CCDS DB by Nucleotide ID:NM_001401Re-query CCDS DB by Protein ID:NP_001392Link to BLink:NP_001392.2
Original member NCBI NM_057159.2 NP_476500.1 Updated not alive Link to Nucleotide Sequence:NM_057159.2Link to Protein Sequence:NP_476500.1Re-query CCDS DB by Nucleotide ID:NM_057159Re-query CCDS DB by Protein ID:NP_476500
Current member NCBI NM_057159.3 NP_476500.1 Accepted alive Link to Nucleotide Sequence:NM_057159.3Link to Protein Sequence:NP_476500.1Re-query CCDS DB by Nucleotide ID:NM_057159Re-query CCDS DB by Protein ID:NP_476500Link to BLink:NP_476500.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001392.2 364 Q92633-1 364 100% 0 0
NP_476500.1 364 Q92633-1 364 100% 0 0

Chromosomal Locations for CCDS 6777.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '-' strand of Chromosome 9 (NC_000009.12)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 9Link to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 110875421 110875722 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 110941421 110942168 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 110972073 110972117 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1095 nt):
ATGGCTGCCATCTCTACTTCCATCCCTGTAATTTCACAGCCCCAGTTCACAGCCATGAATGAACCACAGT
GC
TTCTACAACGAGTCCATTGCCTTCTTTTATAACCGAAGTGGAAAGCATCTTGCCACAGAATGGAACAC
A
GTCAGCAAGCTGGTGATGGGACTTGGAATCACTGTTTGTATCTTCATCATGTTGGCCAACCTATTGGTC
ATG
GTGGCAATCTATGTCAACCGCCGCTTCCATTTTCCTATTTATTACCTAATGGCTAATCTGGCTGCTG
CA
GACTTCTTTGCTGGGTTGGCCTACTTCTATCTCATGTTCAACACAGGACCCAATACTCGGAGACTGAC
T
GTTAGCACATGGCTCCTTCGTCAGGGCCTCATTGACACCAGCCTGACGGCATCTGTGGCCAACTTACTG
GCT
ATTGCAATCGAGAGGCACATTACGGTTTTCCGCATGCAGCTCCACACACGGATGAGCAACCGGCGGG
TA
GTGGTGGTCATTGTGGTCATCTGGACTATGGCCATCGTTATGGGTGCTATACCCAGTGTGGGCTGGAA
C
TGTATCTGTGATATTGAAAATTGTTCCAACATGGCACCCCTCTACAGTGACTCTTACTTAGTCTTCTGG
GCC
ATTTTCAACTTGGTGACCTTTGTGGTAATGGTGGTTCTCTATGCTCACATCTTTGGCTATGTTCGCC
AG
AGGACTATGAGAATGTCTCGGCATAGTTCTGGACCCCGGCGGAATCGGGATACCATGATGAGTCTTCT
G
AAGACTGTGGTCATTGTGCTTGGGGCCTTTATCATCTGCTGGACTCCTGGATTGGTTTTGTTACTTCTA
GAC
GTGTGCTGTCCACAGTGCGACGTGCTGGCCTATGAGAAATTCTTCCTTCTCCTTGCTGAATTCAACT
CT
GCCATGAACCCCATCATTTACTCCTACCGCGACAAAGAAATGAGCGCCACCTTTAGGCAGATCCTCTG
C
TGCCAGCGCAGTGAGAACCCCACCGGCCCCACAGAAGGCTCAGACCGCTCGGCTTCCTCCCTCAACCAC
ACC
ATCTTGGCTGGAGTTCACAGCAATGACCACTCTGTGGTTTAG


Translation (364 aa):
MAAISTSIPVISQPQFTAMNEPQCFYNESIAFFYNRSGKHLATEWNTVSKLVMGLGITVCIFIMLANLLV
M
VAIYVNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVSTWLLRQGLIDTSLTASVANLL
A
IAIERHITVFRMQLHTRMSNRRVVVVIVVIWTMAIVMGAIPSVGWNCICDIENCSNMAPLYSDSYLVFW
A
IFNLVTFVVMVVLYAHIFGYVRQRTMRMSRHSSGPRRNRDTMMSLLKTVVIVL
GAFIICWTPGLVLLLL
D
VCCPQCDVLAYEKFFLLLAEFNSAMNPIIYSYRDKEMSATFRQILCCQRSENPTGPTEGSDRSASSLNH
T
ILAGVHSNDHSVV




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser