NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS16197.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
16197.1 Public Mus musculus 2 Rtn4rl2 21 106 86 CCDS HistoryNCBI Gene:269295Re-query CCDS DB by CCDS ID:16197.1Re-query CCDS DB by GeneID:269295See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 16197.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000054514 ENSMUSP00000057725 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000054514Link to Ensembl Protein Viewer:ENSMUSP00000057725Re-query CCDS DB by Nucleotide ID:ENSMUST00000054514Re-query CCDS DB by Protein ID:ENSMUSP00000057725
Original member Current member NCBI NM_199223.1 NP_954693.1 Accepted alive Link to Nucleotide Sequence:NM_199223.1Link to Protein Sequence:NP_954693.1Re-query CCDS DB by Nucleotide ID:NM_199223Re-query CCDS DB by Protein ID:NP_954693Link to BLAST:NP_954693.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_954693.1 420 Q7M6Z0 420 100% 0 0

Chromosomal Locations for CCDS 16197.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 84871946 84872695 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 84880388 84880869 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 84886662 84886692 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1263 nt):
ATGCTGCCCGGGCTCCGGCGCCTGCTGCAAGGTCCTGCCTCAGCCTGCCTACTGCTGACACTCCTGGCCC
TT
CCTTCCGTGACCCCCAGCTGTCCTATGCTCTGCACCTGCTACTCCTCCCCGCCCACCGTGAGCTGCCA
G
GCCAACAACTTCTCCTCAGTGCCGCTGTCCTTGCCACCCAGTACACAGAGACTCTTCTTGCAGAACAAC
CTC
ATCCGCTCACTGCGGCCAGGCACCTTTGGGCCCAACCTGCTCACCCTGTGGCTCTTCTCCAACAACC
TC
TCCACCATCCACCCTGGCACCTTCCGCCACCTGCAGGCCCTAGAAGAACTGGACCTCGGTGACAACCG
G
CACCTGCGCTCCCTGGAGCCCGACACCTTCCAGGGTCTGGAGAGGCTGCAGTCACTACACCTGTATCGT
TGC
CAGCTCAGCAGCCTGCCTGGCAACATTTTCCGAGGCTTGGTCAGCCTACAGTACCTCTACCTCCAGG
AG
AACAGCCTGCTCCATCTACAGGATGACTTGTTCGCGGACCTGGCCAACCTGAGCCACCTCTTCCTCCA
C
GGGAACCGCCTGCGGCTGCTCACGGAGCACGTGTTCCGCGGCTTGGGCAGCCTGGACCGGCTGTTGCTG
CAC
GGGAACCGGCTGCAGGGCGTGCACCGCGCGGCTTTCCACGGCCTCAGCCGCCTCACCATCCTCTACC
TG
TTCAACAACAGCCTGGCCTCGCTGCCGGGAGAGGCGCTGGCCGACCTGCCGGCGCTCGAGTTCCTGCG
G
CTCAACGCCAACCCCTGGGCGTGCGACTGCCGCGCTCGGCCGCTCTGGGCTTGGTTCCAGCGCGCGCGG
GTG
TCCAGCTCCGACGTGACCTGCGCCACCCCGCCCGAGCGCCAGGGCCGGGACCTGCGCGCGCTGCGCG
AC
TCCGATTTCCAAGCGTGCCCGCCGCCCACGCCCACGCGGCCGGGCAGCCGCGCCCGCGGCAACAGCTC
T
TCCAACCACCTGTACGGCGTGGCCGAGGCTGGCGCTCCCCCCGCAGACCCGTCCACGCTCTACCGAGAT
CTG
CCCGCCGAGGACTCGCGGGGGCGCCAGGGCGGGGACGCGCCCACCGAGGACGACTACTGGGGGGGCT
AC
GGCGGCGAGGATCAGCGGGGCGAGCAGACGTGTCCCGGGGCCGCGTGCCAGGCGCCCGCAGACTCGCG
T
GGCCCCGCGCTCTCGGCCGGGCTGCGCACCCCTCTGCTCTGCCTCTTGCCCCTGGCGCTCCATCACCTC
TGA


Translation (420 aa):
MLPGLRRLLQGPASACLLLTLLALPSVTPSCPMLCTCYSSPPTVSCQANNFSSVPLSLPPSTQRLFLQNN
L
IRSLRPGTFGPNLLTLWLFSNNLSTIHPGTFRHLQALEELDLGDNRHLRSLEPDTFQGLERLQSLHLYR
C
QLSSLPGNIFRGLVSLQYLYLQENSLLHLQ
DDLFADLANLSHLFLHGNRLRLLTEHVFRGLGSLDRLLL
H
GNRLQGVHRAAFHGLSRLTILYLFNNSLASLPGEALADLPALEFLRLNANPWACDCRARPLWAWFQRAR
V
SSSDVTCATPPERQGRDLRALRDSDFQACPPPTPTRPGSRARGNSSSNHLYGVAEAGAPPADPSTLYRD
L
PAEDSRGRQGGDAPTEDDYWGGYGGEDQRGEQTCPGAACQAPADSRGPALSAGLRTPLLCLLPLALHHL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser