NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS15485.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
15485.1 Reviewed, update pending Mus musculus 1 Adamts4 21 106 86 CCDS HistoryNCBI Gene:240913Re-query CCDS DB by CCDS ID:15485.1Re-query CCDS DB by GeneID:240913See the combined annotation on chromosome 1 in Sequence Viewer

Public Note for CCDS 15485.1
This coding region was updated to represent the use of a downstream start codon based on experimental evidence and conservation.

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)


Attributes
CDS uses downstream AUG

Sequence IDs included in CCDS 15485.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000111315 ENSMUSP00000106947 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000111315Link to Ensembl Protein Viewer:ENSMUSP00000106947Re-query CCDS DB by Nucleotide ID:ENSMUST00000111315Re-query CCDS DB by Protein ID:ENSMUSP00000106947
Original member Current member EBI,WTSI OTTMUST00000051062 OTTMUSP00000023975 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000051062Link to Vega Protein Viewer:OTTMUSP00000023975Re-query CCDS DB by Nucleotide ID:OTTMUST00000051062Re-query CCDS DB by Protein ID:OTTMUSP00000023975
Original member NCBI NM_172845.2 NP_766433.1 Updated not alive Link to Nucleotide Sequence:NM_172845.2Link to Protein Sequence:NP_766433.1Re-query CCDS DB by Nucleotide ID:NM_172845Re-query CCDS DB by Protein ID:NP_766433
Current member NCBI NM_172845.3 NP_766433.2 Accepted alive Link to Nucleotide Sequence:NM_172845.3Link to Protein Sequence:NP_766433.2Re-query CCDS DB by Nucleotide ID:NM_172845Re-query CCDS DB by Protein ID:NP_766433Link to BLAST:NP_766433.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_766433.2 833 Q8BNJ2 833 100% 0 0

Chromosomal Locations for CCDS 15485.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 171250813 171251469 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 171252537 171252860 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 171253087 171253219 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 171253893 171254063 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 171256148 171256434 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 171256528 171256714 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 171256955 171257130 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 171257719 171257894 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 171258752 171259178 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2538 nt):
ATGGCCTCAATCCATCCCAGCTGCAGCCCGGGTACCATGTCCCAGATGGGCTTGCATCCCAGGAGGGGCT
TG
ACTGGGCACTGGCTGCAAAGATTCCAACCCTGCTTGCCGCTTCACACTGTGCAGTGGCGGAGGCTGCT
G
CTGCTGGCCTTCCTCCTGTCCTTAGCGTGGCCCGCCAGCCCCCTCCCCCGGGAGGAGGAGATCGTGTTT
CCA
GAGAAGCTCAATGGCAGTAGCATCCTACCTGGATCAGGCGTTCCTGCCAGGCTGCTGTACCGATTGC
CA
GCCTTTGGGGAGATGTTGCTACTAGAACTAGAACAGGACCCTGGGGTGCAGGTAGAGGGTTTGACTGT
A
CAGTACCTGGGCCAGGCACCTGAGATGCTGGGTGGGGCAGAGCCAGGTACCTACCTGACTGGCACCATC
AAT
GGAGATCCGGAGTCGGTGGCATCTCTGCACTGGGACGGGGGAGCCCTATTAGGGGTACTGCAGTACC
GT
GGGGCCGAACTCCACCTCCAGCCTCTGGAAGGAGGCGCCCTTAACTCTGCTGGGGGACCGGGGGCTCA
C
ATCCTACGCCGGAAGAGTCCTGCCAGCAGCCAAGGTCCCATGTGCACCGTCAAGGCTCCTTCTGGGAGC
CCG
AGTCCCATTTCCCGCAGAACCAAGCGCTTCGCTTCTCTGAGTAGATTCGTGGAGACACTGGTGGTAG
CA
GATGACAAGATGGCAGCATTCCATGGTACAGGGTTAAAGCGCTACCTGCTGACGGTTATGGCAGCTGC
C
GCTAAAGCCTTTAAACACCCAAGCATCCGAAACCCTGTCAACTTGGTGGTGACGCGCCTGGTGATCCTG
GGG
TCCGGCCAGGAAGGGCCCCAAGTGGGGCCAAGTGCCGCCCAGACCCTACGCAGCTTCTGCACCTGGC
AG
CGGGGCCTCAACACCCCTAACGACTCAGATCCTGACCACTTTGACACAGCCATTCTGTTCACCCGGCA
G
GACCTGTGTGGGGTCTCCACTTGTGACACCCTGGGTATGGCTGATGTGGGCACAGTGTGTGATCCAGCT
AGG
AGCTGTGCTATTGTGGAAGATGATGGGCTCCAGTCAGCCTTCACTGCTGCTCATGAACTGGGCCATG
TC
TTCAACATGCTCCATGATAACTCCAAGCCATGCACTAACTTGAATGGGCAGGGGGGTTCCTCTCGCCA
T
GTCATGGCTCCTGTCATGGCCCATGTGGACCCTGAAGAGCCCTGGTCGCCCTGCAGTGCCCGATTCATC
ACT
GACTTCCTGGACAATGGTTATGGGCACTGCCTCTTAGACAAACCGGAGGCTCCCCTCCATCTACCAG
CG
ACTTTTCCTGGCAAGGACTATGACGCTGACCGCCAATGCCAACTGACCTTCGGTCCTGACTCAAGCCA
T
TGTCCACAGCTGCCACCGCCCTGTGCTGCCCTCTGGTGCTCTGGCCACCTCAATGGCCATGCCATGTGC
CAG
ACGAAGCACTCACCTTGGGCTGATGGCACTCCCTGCGGGTCTTCACAGGCCTGCATGGGTGGCCGCT
GT
CTGCACGTGGACCAGCTCAAGGACTTCAATGTTCCTCAGGCTGGAGGCTGGGGCCCCTGGGGACCATG
G
GGTGACTGCTCCAGGACTTGTGGGGGTGGTGTCCAGTTCTCCTCCCGGGATTGCACGAGGCCCGTCCCC
CGG
AACGGTGGCAAGTATTGTGAGGGCCGCCGGACTCGCTTCCGCTCCTGCAACACGGAGAACTGCCCAC
AC
GGCTCAGCATTGACCTTCCGTGAAGAGCAGTGTGCTGCCTACAACCACCGAACCGACCTCTTCAAGAG
C
TTTCCAGGGCCCATGGACTGGGTTCCGCGCTACACAGGTGTGGCCCCTCGAGACCAATGCAAACTCACC
TGC
CAGGCCCGGGCACTGGGCTACTACTACGTATTGGAGCCCCGGGTGGCAGATGGGACTCCCTGCTCCC
CA
GACACCTCCTCTGTCTGTGTCCAGGGCCGCTGTATCCATGCTGGCTGTGACCGGATCATTGGCTCCAA
A
AAGAAATTTGACAAGTGCATGGTGTGCGGCGGGGATGGCTCTCGCTGCAGCAAGCAGTCGGGCTCCTTC
AAA
AAATTCAGGTATGGATACAGCGATGTGGTCACGATCCCTGCGGGGGCCACCCATATCCTTGTACGGC
AG
CAGGGGGGGTCTGGTCTCAAGAGCATCTACCTGGCCCTGAAGCTTTCTGACGGTTCTTACGCCCTCAA
T
GGTGAATACACGCTGATGCCCTCCCCAACAGATGTGGTTCTTCCTGGGGCAGTCAGCTTGCGCTACAGC
GGA
GCCACAGCAGCCTCAGAGACACTGTCTGGACATGGGCCGCTGGCCCAGCCCTTGACGCTGCAAGTCC
TG
GTGGCTGGCAACCCACAGAATGCACGTCTGCGGTACAGTTTCTTTGTCCCGCGGCCAGTCCCTTCAAC
A
CCACGCCCTCCTCCCCAAGACTGGCTGCAACGCAGGGCAGAGATACTGAAGATCCTTCGGAAGCGTCCC
TGG
GCAGGCCGGAAATAA


Translation (845 aa):
MASIHPSCSPGTMSQMGLHPRRGLTGHWLQRFQPCLPLHTVQWRRLLLLAFLLSLAWPASPLPREEEIVF
P
EKLNGSSILPGSGVPARLLYRLPAFGEMLLLELEQDPGVQVEGLTVQYLGQAPEMLGGAEPGTYLTGTI
N
GDPESVASLHWDGGALLGVLQYRGAELHLQPLEGGALNSAGGPGAHILRRKSPASSQGPMCTVKAPSGS
P
SPISRRTK
RFASLSRFVETLVVADDKMAAFHGTGLKRYLLTVMAAAAKAFKHPSIRNPVNLVVTRLVIL
G
SGQEGPQVGPSAAQTLRSFCTWQRGLNTPNDSDPDHFDTAILFTRQ
DLCGVSTCDTLGMADVGTVCDPA
R
SCAIVEDDGLQSAFTAAHEL
GHVFNMLHDNSKPCTNLNGQGGSSRHVMAPVMAHVDPEEPWSPCSARFI
T
DFLDNGY
GHCLLDKPEAPLHLPATFPGKDYDADRQCQLTFGPDSSHCPQLPPPCAALWCSGHLNGHAMC
Q
TKHSPWADGTPCGSSQACMGGRCLHVDQLKDFN
VPQAGGWGPWGPWGDCSRTCGGGVQFSSRDCTRPVP
R
NGGKYCEGRRTRFRSCNTENCPHGS
ALTFREEQCAAYNHRTDLFKSFPGPMDWVPRYTGVAPRDQCKLT
C
QARALGYYYVLEPR
VADGTPCSPDTSSVCVQGRCIHAGCDRIIGSKKKFDKCMVCGGDGSRCSKQSGSF
K
KF
RYGYSDVVTIPAGATHILVRQQGGSGLKSIYLALKLSDGSYALNGEYTLMPSPTDVVLPGAVSLRYS
G
ATAASETLSGHGPLAQPLTLQVLVAGNPQNARLRYSFFVPRPVPSTPRPPPQDWLQRRAEILKILRKRP
W
AGRK




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser