NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS16552.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
16552.1 Public Mus musculus 2 Slc12a6 21 106 86 CCDS HistoryNCBI Gene:107723Re-query CCDS DB by CCDS ID:16552.1Re-query CCDS DB by GeneID:107723See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 16552.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000053666 ENSMUSP00000051490 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000053666Link to Ensembl Protein Viewer:ENSMUSP00000051490Re-query CCDS DB by Nucleotide ID:ENSMUST00000053666Re-query CCDS DB by Protein ID:ENSMUSP00000051490
Original member Current member EBI,WTSI OTTMUST00000035918 OTTMUSP00000016123 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000035918Link to Vega Protein Viewer:OTTMUSP00000016123Re-query CCDS DB by Nucleotide ID:OTTMUST00000035918Re-query CCDS DB by Protein ID:OTTMUSP00000016123
Original member Current member NCBI NM_133648.2 NP_598409.2 Accepted alive Link to Nucleotide Sequence:NM_133648.2Link to Protein Sequence:NP_598409.2Re-query CCDS DB by Nucleotide ID:NM_133648Re-query CCDS DB by Protein ID:NP_598409Link to BLink:NP_598409.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_598409.2 1099 Q924N4-2 1099 100% 0 0

Chromosomal Locations for CCDS 16552.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 2Link to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 112284688 112284805 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 112316241 112316285 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 112333383 112333477 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 112334369 112334500 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 112335776 112335922 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 112337358 112337412 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 112337859 112337989 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 112339246 112339487 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 112341831 112342045 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 112343829 112343987 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 112344139 112344237 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 112344488 112344545 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 112346899 112347073 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 112347317 112347435 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 112349276 112349374 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 112351279 112351398 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 112352444 112352548 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 112352892 112353060 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 112354174 112354369 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 112354975 112355144 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 112356460 112356591 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 112357484 112357591 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 112357768 112357952 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 112358506 112358639 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 112360416 112360507 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3300 nt):
ATGCCGCACTTCACTGTGACCAAGGTAGAAGACCCAGAGGAGGGGGCAGCTGGCCCCCTCTCTCCTGAGC
CC
AGCTCAGCAGAAGTAAAAGCCCGGATTCAGGATCCCCAAGAACCAGACCCGAGTCAGAACTCCATCAC
A
GGGGAGCACAGCCAGCTGTTAGATGACGGCCATAAAAAAGCCCGAAATGCTTATCTCAATAATTCCAAC
TAT
GAAGAAGGAGACGAATATTTTGATAAAAATTTGGCACTCTTTGAGGAAGAAATGGACACCAGACCAA
AG
GTGTCTTCTCTCCTCAACCGCATGGCCAACTATACAAATCTGACACAAGGAGCAAAGGAACATGAAGA
G
GCAGAGAACATCACTGAAGGGAAAAAGAAGCCTACCAAGAGCCCCCAAATGGGTACTTTCATGGGTGTC
TAC
CTCCCATGTCTACAGAACATCTTTGGAGTGATCCTCTTCCTGCGTCTTACCTGGGTAGTGGGAACAG
CT
GGAATCCTTCAGGCCTTTGCAATTGTCCTCATCTGCTGCTGCTGTACAATGTTAACTGCCATCTCCAT
G
AGCGCCATCGCCACTAACGGAGTGGTGCCAGCTGGGGGCTCATACTTCATGATTTCCAGAGCCCTGGGC
CCA
GAGTTTGGCGGGGCTGTAGGCCTCTGCTTTTATCTTGGCACCACATTTGCAGCAGCCATGTATATTC
TT
GGTGCCATTGAAATCTTTCTGGTATACATTGTCCCCCGAGCTGCCATCTTTCGGAGTGACGATGCACT
C
AAGGAGTCAGCAGCTATGCTGAACAACATGCGCGTCTATGGTACAGCCTTCTTGGTCCTCATGGTCTTG
GTG
GTATTCATCGGCGTACGCTATGTGAATAAGTTTGCCTCACTCTTCCTGGCCTGTGTAATTGTGTCGA
TC
TTGGCTATCTATGCTGGTGCCATCAAGTCTTCCTTTGCTCCACCACACTTCCCGGTCTGTATGCTGGG
C
AACCGTACCCTGTCATCAAGACACCTTGACATTTGCTCTAAGACCAAGGAGGTTGACAACATGACAGTA
CCA
TCAAAGTTATGGGGATTCTTCTGCAACTCGAGTCAGTTCTTTAATGCCACCTGTGATGAGTACTTTG
TT
CACAATAACGTCATCTCAATCCAAGGCATTCCAGGGTTGGCTAGTGGTATCATTACTGAAAATCTTTG
G
AGTAATTATTTACCAAAGGGTGAGATAATTGAAAAGCCATCAGCCAAGTCATCTGATGTCTTAGGCAAC
TTA
AACCATGAATATGTTCTTGCTGATATCACCACCTCCTTCACTCTGCTGGTGGGGATCTTCTTTCCCT
CG
GTCACAGGTATCATGGCTGGGTCAAACAGATCTGGAGATCTGAAAGATGCCCAGAAGTCTATTCCCAT
T
GGGACCATCCTTGCCATCCTGACCACATCCTTTGTGTATTTAAGCAATGTTGTCCTTTTTGGTGCATGT
ATT
GAAGGAGTCGTTCTCAGAGACAAATTTGGGGATGCTGTAAAAGGGAATTTGGTTGTAGGCACCTTAT
CC
TGGCCATCCCCGTGGGTGATCGTTATTGGCTCCTTCTTTTCAACATGTGGGGCTGGGCTGCAGAGCCT
C
ACAGGTGCGCCTCGGCTGCTGCAGGCTATCGCCAAGGATAACATCATACCTTTCCTTAGGGTTTTTGGT
CAC
AGCAAAGCTAATGGGGAACCTACCTGGGCTTTACTTCTAACTGCTGCCATAGCAGAGCTGGGAATTC
TC
ATCGCCTCCCTGGATCTCGTGGCCCCAATTCTTTCCATGTTTTTTCTCATGTGTTACCTCTTTGTGAA
C
TTGGCTTGTGCCTTGCAAACATTGCTGCGAACCCCCAACTGGAGGCCTCGATTCCGCTATTATCACTGG
GCC
CTCTCTTTCATGGGAATGAGTATCTGTCTAGCTCTGATGTTCATTTCTTCTTGGTATTATGCCATTG
TA
GCTATGGTAATAGCTGGCATGATCTACAAGTACATTGAATATCAAGGGGCTGAGAAAGAATGGGGGGA
T
GGTATCCGTGGGCTGTCGCTCAGTGCAGCCCGCTTCGCTTTGCTCCGTCTAGAGGAAGGACCTCCTCAC
ACT
AAAAACTGGAGGCCTCAGCTGCTCGTCCTACTGAAGCTGGATGAAGATTTACACGTCAAGCACCCTC
GC
CTCCTCACCTTTGCCTCCCAGCTCAAGGCAGGAAAGGGACTCACGATTGTGGGCTCTGTCATCGTGGG
G
AACTTCTTGGAGAACTATGGTGACGCGCTCGCGGCAGAGCAGACCATTAAGCACCTAATGGAGGCAGAA
AAG
GTAAAAGGATTCTGCCAATTGGTGGTGGCTGCCAAGCTGAAAGAGGGCATTTCACACCTCATCCAGT
CC
TGTGGCCTCGGAGGCATGAAACACAACACAGTGGTGATGGGCTGGCCCAATGGCTGGCGTCAGAGTGA
A
GATGCTCGCGCTTGGAAGACTTTCATTGGCACAGTACGAGTGACAACTGCTGCCCATCTAGCCCTGCTG
GTG
GCTAAAAATGTCTCCTTCTTTCCCAGCAATGTGGAGCAGTTTTCTGAGGGCAACATTGATGTGTGGT
GG
ATTGTGCATGATGGGGGCATGCTCATGCTATTACCGTTCCTGCTGAAACAGCACAAGGTTTGGCGGAA
A
TGCAGCATACGGATCTTCACAGTAGCCCAACTAGAAGACAACAGTATCCAGATGAAGAAGGATCTGGCC
ACC
TTTCTGTACCACCTGCGCATTGAGGCAGAAGTGGAAGTGGTGGAGATGCACGACAGTGACATATCTG
CC
TATACATATGAGCGCACCCTGATGATGGAGCAGAGGTCCCAGATGCTTCGGCATATGCGGCTGTCCAA
A
ACAGAGCGAGACAGGGAGGCACAGCTGGTGAAAGATCGAAACTCAATGCTACGCTTGACCAGCATTGGC
TCT
GATGAGGACGAAGAGACAGAAACGTACCAGGAGAAGGTGCACATGACTTGGACCAAGGATAAATACA
TG
GCATCCCGGGGGCAAAAGGTCAAGTCAATGGAAGGATTCCAGGACCTACTTAATATGCGTCCGGACCA
G
TCCAACGTGAGACGGATGCATACAGCAGTGAAGCTCAATGAAGTTATAGTCAACAAGTCTCATGAAGCA
AAG
CTGGTTTTGTTGAATATGCCAGGACCACCCCGGAACCCTGAAGGTGATGAAAACTACATGGAATTTC
TA
GAAGTGCTCACTGAGGGATTAGAACGAGTCCTTCTTGTCCGGGGTGGTGGCAGTGAGGTCATCACCAT
T
TACTCATAA


Translation (1099 aa):
MPHFTVTKVEDPEEGAAGPLSPEPSSAEVKARIQDPQEPDPSQNSITGEHSQLLDDGHKKARNAYLNNSN
Y
EEGDEYFDKNLALFE
EEMDTRPKVSSLLNRMANYTNLTQGAKEHEEAENITEGKKKPTKSPQMGTFMGV
Y
LPCLQNIFGVILFLRLTWVVGTAGILQAFAIVLICCCC
TMLTAISMSAIATNGVVPAGGSYFMISRALG
P
EFGGAVGLCFYLGTTFAAAMYILGAIEIFL
VYIVPRAAIFRSDDALKESAAMLNNMRVYGTAFLVLMVL
V
VFIGVRYVNKFASLFLACVIVSILAIYAGAIKSSFAPPHF
PVCMLGNRTLSSRHLDICSKTKEVDNMTV
P
SKLWGFFCNSSQFFNATCDEYFVHNNVISIQGIPGLASGIIT
ENLWSNYLPKGEIIEKPSAKSSDVLGN
L
NHEYVLADITTSFTLLVGIFFPSVT
GIMAGSNRSGDLKDAQKSIPIGTILAILTTSFVYLSNVVLFGAC
I
EGVVLRD
KFGDAVKGNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPFLRVFG
H
SKANGEPTWALLLTAAIAELGILIASLDLVAPILS
MFFLMCYLFVNLACALQTLLRTPNWRPRFRYYHW
A
LSFMGMSICLALMFISSWYYAIVAMVIAGMIYKYIEYQ
GAEKEWGDGIRGLSLSAARFALLRLEEGPPH
T
KNW
RPQLLVLLKLDEDLHVKHPRLLTFASQLKAGKGLTIVGSVIVGNFLENYGDALAAEQTIKHLMEAE
K
VKGFCQLVVAAKLKEGISHLIQSCGLGGMKHNTVVMGWPNGWRQSEDARAWKTFI
GTVRVTTAAHLALL
V
AKNVSFFPSNVEQFSEGNIDVWWIVHDGGMLMLLPFLLKQHK
VWRKCSIRIFTVAQLEDNSIQMKKDLA
T
FLYHLRIEAEVEVVEM
HDSDISAYTYERTLMMEQRSQMLRHMRLSKTERDREAQLVKDRNSMLRLTSIG
S
DEDEETETYQEKVHMTWTKDKYMASRGQKVKSMEGFQDLLNMR
PDQSNVRRMHTAVKLNEVIVNKSHEA
K
LVLLNMPGPPRNPEGDEN
YMEFLEVLTEGLERVLLVRGGGSEVITIYS



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser