NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS40340.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
40340.1 Public Mus musculus 8 Glra3 21 106 86 CCDS HistoryNCBI Gene:110304Re-query CCDS DB by CCDS ID:40340.1Re-query CCDS DB by GeneID:110304See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 40340.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000000275 ENSMUSP00000000275 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000000275Link to Ensembl Protein Viewer:ENSMUSP00000000275Re-query CCDS DB by Nucleotide ID:ENSMUST00000000275Re-query CCDS DB by Protein ID:ENSMUSP00000000275
Original member Current member EBI,WTSI OTTMUST00000093512 OTTMUSP00000051884 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000093512Link to Vega Protein Viewer:OTTMUSP00000051884Re-query CCDS DB by Nucleotide ID:OTTMUST00000093512Re-query CCDS DB by Protein ID:OTTMUSP00000051884
Original member Current member NCBI NM_080438.2 NP_536686.2 Accepted alive Link to Nucleotide Sequence:NM_080438.2Link to Protein Sequence:NP_536686.2Re-query CCDS DB by Nucleotide ID:NM_080438Re-query CCDS DB by Protein ID:NP_536686Link to BLink:NP_536686.2

Chromosomal Locations for CCDS 40340.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 8 (NC_000074.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 8Link to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 55940856 55940974 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 55991126 55991253 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 56005117 56005184 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 56039582 56039805 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 56062431 56062513 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 56085114 56085251 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 56088984 56089198 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 56110447 56110590 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 56112830 56112874 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 56125074 56125352 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1443 nt):
ATGCCTTGGATAAGACTGCTTTCAGGATCGTGGATCTCTTTCCGTATCATGGCCCACGTGAGACACTTTC
GG
ACACTAGTTTCTGGATTTTACTTCTGGGAAGCCGCACTGTTACTGAGTTTGGTGGCCACAAAGGAAAC
A
AACAGTGCGCGATCTCGAAGTGCTCCAATGTCACCTTCTGATTTTCTGGACAAACTAATGGGGAGGACA
TCG
GGGTATGATGCAAGAATCAGACCCAACTTCAAAGGTCCTCCAGTTAATGTCACATGCAACATATTCA
TA
AACAGCTTTGGCTCCATTGCAGAGACGACTATGGATTACAGAGTAAACATTTTTCTTCGTCAGAAGTG
G
AATGATCCTCGTCTTGCATACAGTGAATATCCTGACGATTCATTAGACCTTGACCCGTCTATGTTGGAT
TCC
ATTTGGAAACCTGACTTGTTCTTTGCTAATGAGAAGGGGGCTAACTTCCACGAAGTCACCACAGATA
AC
AAGCTGCTAAGAATTTTCAAAAATGGAAATGTCCTTTATTCAATAAGGTTGACATTAACACTCTCCTG
T
CCAATGGATCTCAAGAATTTCCCAATGGATGTACAAACATGCATAATGCAACTTGAAAGCTTTGGGTAC
ACA
ATGAATGATCTCATTTTTGAATGGCAAGATGAAGCCCCAGTACAAGTGGCTGAAGGACTCACTTTGC
CT
CAATTTCTGTTGAAAGAAGAAAAGGACTTGCGGTACTGCACTAAACACTACAATACAGGAAAGTTTAC
A
TGCATAGAAGTGCGATTCCATCTTGAGCGTCAGATGGGCTATTACTTGATCCAGATGTACATCCCCAGC
CTC
CTGATCGTTATTCTATCCTGGGTCTCATTCTGGATTAACATGGATGCAGCCCCAGCTAGAGTAGCTT
TG
GGCATCACCACTGTACTTACTATGACCACACAGAGTTCTGGATCCCGGGCCTCCTTACCAAAGGTGTC
A
TACGTCAAGGCTATTGACATTTGGATGGCGGTGTGCCTCCTTTTTGTGTTCTCAGCACTTCTGGAGTAT
GCA
GCCGTGAATTTTGTCTCAAGGCAACACAAGGAGCTGTTGAGGTTTCGGCGAAAGAGAAAGAATAAGA
CG
GAAGCTTTTGCACTGGAGAAGTTTTACCGTTTCTCAGACACGGATGATGAGGTGAGGGAGAGTCGATT
C
AGCTTCACTGCCTATGGAATGGGGCCCTGTCTGCAAGCCAAGGATGGTGTGGTTCCAAAAGGCCCCAAC
CAC
GCTGTCCAGGTCATGCCAAAGAGCCCTGATGAAATGAGGAAGGTCTTCATCGACAGGGCTAAGAAGA
TT
GACACCATCTCCCGAGCCTGCTTTCCGCTAGCATTCCTGATTTTTAACATTTTCTACTGGGTTATCTA
T
AAAATCCTTAGGCATGAAGACATTCATCAGCAGCAAGACTAA


Translation (480 aa):
MPWIRLLSGSWISFRIMAHVRHFRTLVSGFYFWEAALLLSLVATKETNSARSRSAPMSPSDFLDKLMGRT
S
GYDARIRPNFK
GPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRLAYSEYPDDSLDLDPSMLD
S
IWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSI
RLTLTLSCPMDLKNFPMDVQTCIMQLESFGY
T
MNDLIFEWQDEAPVQVAEGLTLPQFLLKEEKDLRYCTKHYNT
GKFTCIEVRFHLERQMGYYLIQMYIPS
L
LIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPK
VSYVKAIDIWMAVCLLFVFSALLEY
A
AVNFVSRQHKELLRFRRKRKNK
TEAFALEKFYRFSDTDDEVRESRFSFTAYGMGPCLQAKDGVVPKGPN
H
AVQVMPKSPDEMRKVFIDRAKKIDTISRACFPLAFLIFNIFYWVIYKILRHEDIHQQQD




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser