NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS52801.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
52801.1 Public Mus musculus 9 Nrg4 21 106 86 CCDS HistoryNCBI Gene:83961Re-query CCDS DB by CCDS ID:52801.1Re-query CCDS DB by GeneID:83961See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)


Attributes
Nonsense-mediated decay (NMD) candidate

Sequence IDs included in CCDS 52801.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000130158 ENSMUSP00000115247 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000130158Link to Ensembl Protein Viewer:ENSMUSP00000115247Re-query CCDS DB by Nucleotide ID:ENSMUST00000130158Re-query CCDS DB by Protein ID:ENSMUSP00000115247
Original member Current member EBI,WTSI ENSMUST00000164721 ENSMUSP00000130929 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000164721Link to Ensembl Protein Viewer:ENSMUSP00000130929Re-query CCDS DB by Nucleotide ID:ENSMUST00000164721Re-query CCDS DB by Protein ID:ENSMUSP00000130929
Original member Current member EBI,WTSI OTTMUST00000060268 OTTMUSP00000029389 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000060268Link to Vega Protein Viewer:OTTMUSP00000029389Re-query CCDS DB by Nucleotide ID:OTTMUST00000060268Re-query CCDS DB by Protein ID:OTTMUSP00000029389
Original member Current member NCBI NM_032002.2 NP_114391.1 Accepted alive Link to Nucleotide Sequence:NM_032002.2Link to Protein Sequence:NP_114391.1Re-query CCDS DB by Nucleotide ID:NM_032002Re-query CCDS DB by Protein ID:NP_114391Link to BLink:NP_114391.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_114391.1 115 Q9WTX4-1 115 100% 0 0

Chromosomal Locations for CCDS 52801.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 9Link to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 55227922 55227938 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 55236440 55236519 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 55242061 55242207 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 55280890 55280983 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 55282551 55282560 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (348 nt):
ATGCCAACAGATCACGAGCAGCCCTGTGGTCCCAGGCACAGGTCATTTTGCCTCAATGGGGGGATTTGTT
AT
GTGATCCCTACTATCCCCAGCCCATTCTGTAGGTGCATTGAAAATTACACCGGAGCACGCTGCGAAGA
G
GTTTTTCTCCCAAGCTCCAGCATCCCAAGCGAAAGTAATCTGTCGGCAGCTTTCGTGGTGCTGGCGGTC
CTC
CTCACTCTTACCATCGCGGCGCTCTGCTTCCTGTGCAGGAAGGGCCACCTTCAGAGGGCCAGTTCAG
TC
CAGTGTGAGATCAGCCTGGTAGAGACAAACAATACCAGAACCCGTCACAGCCACAGAGAACACTGA


Translation (115 aa):
MPTDHEQPCGPRHRSFCLNGGICYVIPTIPSPFCRCIENYTGARCEEVFLPSSSIPSESNLSAAFVVLAV
L
LTLTIAALCFLC
RKGHLQRASSVQCEISLVETNNTRTRHSHREH



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser