NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS19153.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19153.1 Public Mus musculus 5 Il6 21 106 86 CCDS HistoryNCBI Gene:16193Re-query CCDS DB by CCDS ID:19153.1Re-query CCDS DB by GeneID:16193See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 19153.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000026845 ENSMUSP00000026845 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000026845Link to Ensembl Protein Viewer:ENSMUSP00000026845Re-query CCDS DB by Nucleotide ID:ENSMUST00000026845Re-query CCDS DB by Protein ID:ENSMUSP00000026845
Original member Current member EBI,WTSI OTTMUST00000135092 OTTMUSP00000071554 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000135092Link to Vega Protein Viewer:OTTMUSP00000071554Re-query CCDS DB by Nucleotide ID:OTTMUST00000135092Re-query CCDS DB by Protein ID:OTTMUSP00000071554
Original member Current member NCBI NM_031168.2 NP_112445.1 Accepted alive Link to Nucleotide Sequence:NM_031168.2Link to Protein Sequence:NP_112445.1Re-query CCDS DB by Nucleotide ID:NM_031168Re-query CCDS DB by Protein ID:NP_112445Link to BLink:NP_112445.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_112445.1 211 P08505 211 100% 0 0

Chromosomal Locations for CCDS 19153.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 5Link to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 30013192 30013210 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 30013376 30013560 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 30014832 30014945 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 30018005 30018154 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 30019381 30019548 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (636 nt):
ATGAAGTTCCTCTCTGCAAGAGACTTCCATCCAGTTGCCTTCTTGGGACTGATGCTGGTGACAACCACGG
CC
TTCCCTACTTCACAAGTCCGGAGAGGAGACTTCACAGAGGATACCACTCCCAACAGACCTGTCTATAC
C
ACTTCACAAGTCGGAGGCTTAATTACACATGTTCTCTGGGAAATCGTGGAAATGAGAAAAGAGTTGTGC
AAT
GGCAATTCTGATTGTATGAACAACGATGATGCACTTGCAGAAAACAATCTGAAACTTCCAGAGATAC
AA
AGAAATGATGGATGCTACCAAACTGGATATAATCAGGAAATTTGCCTATTGAAAATTTCCTCTGGTCT
T
CTGGAGTACCATAGCTACCTGGAGTACATGAAGAACAACTTAAAAGATAACAAGAAAGACAAAGCCAGA
GTC
CTTCAGAGAGATACAGAAACTCTAATTCATATCTTCAACCAAGAGGTAAAAGATTTACATAAAATAG
TC
CTTCCTACCCCAATTTCCAATGCTCTCCTAACAGATAAGCTGGAGTCACAGAAGGAGTGGCTAAGGAC
C
AAGACCATCCAATTCATCTTGAAATCACTTGAAGAATTTCTAAAAGTCACTTTGAGATCTACTCGGCAA
ACC
TAG


Translation (211 aa):
MKFLSARDFHPVAFLGLMLVTTTAFPTSQVRRGDFTEDTTPNRPVYTTSQVGGLITHVLWEIVEMRKELC
N
GNSDCMNNDDALAENNLKLPEIQRNDGCYQTGYNQ
EICLLKISSGLLEYHSYLEYMKNNLKDNKKDKAR
V
LQRDTETLIHIFNQE
VKDLHKIVLPTPISNALLTDKLESQKEWLRTKTIQFILKSLEEFLKVTLRSTRQ
T




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser