NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS24204.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
24204.1 Public Mus musculus 10 Irak3 21 106 86 CCDS HistoryNCBI Gene:73914Re-query CCDS DB by CCDS ID:24204.1Re-query CCDS DB by GeneID:73914See the combined annotation on chromosome 10 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 24204.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000020448 ENSMUSP00000020448 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000020448Link to Ensembl Protein Viewer:ENSMUSP00000020448Re-query CCDS DB by Nucleotide ID:ENSMUST00000020448Re-query CCDS DB by Protein ID:ENSMUSP00000020448
Original member Current member EBI,WTSI OTTMUST00000086213 OTTMUSP00000046651 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000086213Link to Vega Protein Viewer:OTTMUSP00000046651Re-query CCDS DB by Nucleotide ID:OTTMUST00000086213Re-query CCDS DB by Protein ID:OTTMUSP00000046651
Original member Current member NCBI NM_028679.3 NP_082955.2 Accepted alive Link to Nucleotide Sequence:NM_028679.3Link to Protein Sequence:NP_082955.2Re-query CCDS DB by Nucleotide ID:NM_028679Re-query CCDS DB by Protein ID:NP_082955Link to BLink:NP_082955.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_082955.2 609 Q8K4B2 609 100% 0 0

Chromosomal Locations for CCDS 24204.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 10 (NC_000076.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 10Link to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 120142715 120143191 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 120145646 120145810 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 120145898 120145960 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 120146431 120146629 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 120165093 120165211 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 120166405 120166519 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 120170318 120170382 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 120176231 120176382 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 120178068 120178122 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 120178696 120178799 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 120182526 120182708 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 120201327 120201459 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1830 nt):
ATGGCCGGCCGGTGCGGGGCCCGTGGCGCGCTGTCGCCACAGTTGCTGCTCTTCGACCTGCCGCCCGCAC
TG
CTGGGAGAGCTTTGCGGGATCCTGGACAGCTGCGATGGCCCGCTCGGCTGGCGGGGCCTGGCGGAGCG
A
CTTTCAAACAGCTGGCTGGATGTTCGTCATATTGAAAAGTACGTAAACCAAGGTAAAAGTGGAACAAGA
GAA
TTGCTCTGGTCCTGGGCACAGAAAAACAAGACGATCGGCGACCTTTTAGAGGTTCTCCAGGACATGG
GG
CATCAACGAGCTATCCACTTAATCATCAACTATGGAGTAAGCTGGACTCCTTCAGTGCAGACGCATCA
C
GAGCTTCCATTCCCCAGCTTCCCACCTGAGGTGAAGCATGCGTGCAGAGAAAACGACCCTGGACCTCTG
GAA
CCAGCCAATGTCACAGTGGATAATGTTCTTGTTCCTGAACATAATGAAAAAGGAACACTGCAGAAAA
CC
CCTATCAGCTTCCAGAGTATCCTAGAAGGAACCAAACATTTCCACAAAGACTTCCTGATTGGAGAAGG
G
GAGATATTCGAAGTATACAGAGTGGACATTCGAAACCAAGCATATGCTGTTAAATTGTTTAAACAGGAG
AAA
AAAATGCAACTAAAGAAGCACTGGAAGAGATTTTTATCAGAACTGGAAGTTCTACTCCTGTTCCGTC
AC
CCCCACATACTAGAGCTGGCTGCATATTTCACGGAGACTGAGAAACTTTGTCTGGTTTATCCCTATAT
G
AGCAACGGGACGCTTTTCGACAGATTACAGTGCACAAATGGCACAACCCCGCTTTCCTGGCACGTTCGA
ATC
AGCGTATTGATAGGAATAGCCAAAGCCATCCAATACTTGCACAACACTCAGCCGTGCGCCGTCATCT
GT
GGCAACGTTTCCAGTGCAAACATACTCTTGGATGACCAGCTCCAACCCAAACTAACGGATTTTGCTGC
A
GCGCACTTCCGACCCAATCTAGAGCAGCAGAGTTCTACCATAAATATGACCGGCGGTGGCAGGAAACAT
CTG
TGGTACATGCCAGAAGAATACATCAGACAGGGAAGACTTTCCGTTAAAACTGATGTCTACAGCTTCG
GA
ATCGTGATCATGGAGGTTCTAACGGGCTGCAAAGTGGTGCTGGATGACCCGAAACACGTTCAGCTGCG
G
GACCTCCTCATGGAACTGATGGAGAAAAGAGGCCTAGACTCCTGCCTGTCCTTCTTAGACAGGAAGATA
CCA
CCCTGTCCTCGGAACTTCTCTGCAAAGCTCTTCTCTCTGGCGGGCCGGTGTGTGGCAACGAAGGCCA
AG
TTAAGACCCACGATGGACGAAGTCCTGTCCTCTCTGGAGAGCACCCAGCCTAGCTTGTATTTTGCAGA
A
GACCCTCCCACGTCCTTGAAGTCCTTCAGGTGTCCTTCTCCACTGTTCTTGGATAATGTCCCAAGTATT
CCA
GTAGAAGATGATGAAAACCAGAATAACCATTCAGTACCTCCCAAGGAAGTTTTGGGGACAGATAGAG
TG
ACTCAGAAAACCCCCTTTGAATGCAGCCAGTCTGAGGTCACCTTTCTAGGCTTGGACCGAAACAGAGG
G
AACAGGGGAAGTGAAGCGGATTGCAACGTGCCCAGTTCTTCTCATGAGGAATGCTGGTCCCCAGAGCTT
GTG
GCGCCATCCCAGGACTTAAGTCCTACTGTGATCAGTTTGGGCTCGTCTTGGGAAGTACCAGGCCATT
CT
TATGGGAGCAAGCCAATGGAGAAGAGGTGTTCCTCTGGGCTCTTTTGCAGTGAGCATGAACAGTCCAA
A
AAGCAGTGA


Translation (609 aa):
MAGRCGARGALSPQLLLFDLPPALLGELCGILDSCDGPLGWRGLAERLSNSWLDVRHIEKYVNQGKSGTR
E
LLWSWAQKNKTIGDLLEVLQDMGHQRAIHLIINY
GVSWTPSVQTHHELPFPSFPPEVKHACRENDPGPL
E
PANVTVDNVLVPEHNEK
GTLQKTPISFQSILEGTKHFHKDFLIGEGEIFEVYRVDIRNQAYAVKLFKQE
K
KMQLKKHWKRFLSELEVLL
LFRHPHILELAAYFTETEKLCLVYPYMSNGTLFDRLQCTNGTTPLSWHVR
I
SVLIGIAKAIQYLHNTQPCAVICGNVS
SANILLDDQLQPKLTDFAAAHFRPNLEQQSSTINMTGGGRKH
L
WYMPEEYIRQGRLSVKTDVYSFGI
VIMEVLTGCKVVLDDPKHVQLRDLLMELMEKRGLDSCLSFLDRKI
P
PCPRNFSAKLFSLAGRCVATKAKLRPTMDE
VLSSLESTQPSLYFAEDPPTSLKSFRCPSPLFLDNVPSI
P
VEDDENQNNHSVPPKEVLGTDRVTQKTPFECSQSEVTFLGLDRNRGNRGSEADCNVPSSSHEECWSPEL
V
APSQDLSPTVISLGSSWEVPGHSYGSKPMEKRCSSGLFCSEHEQSKKQ




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser