NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS41096.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
41096.1 Public Mus musculus X Cox7b 21 106 86 CCDS HistoryNCBI Gene:66142Re-query CCDS DB by CCDS ID:41096.1Re-query CCDS DB by GeneID:66142See the combined annotation on chromosome X in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 41096.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000033582 ENSMUSP00000033582 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000033582Link to Ensembl Protein Viewer:ENSMUSP00000033582Re-query CCDS DB by Nucleotide ID:ENSMUST00000033582Re-query CCDS DB by Protein ID:ENSMUSP00000033582
Original member Current member EBI,WTSI OTTMUST00000044174 OTTMUSP00000019859 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000044174Link to Vega Protein Viewer:OTTMUSP00000019859Re-query CCDS DB by Nucleotide ID:OTTMUST00000044174Re-query CCDS DB by Protein ID:OTTMUSP00000019859
Original member Current member NCBI NM_025379.2 NP_079655.1 Accepted alive Link to Nucleotide Sequence:NM_025379.2Link to Protein Sequence:NP_079655.1Re-query CCDS DB by Nucleotide ID:NM_025379Re-query CCDS DB by Protein ID:NP_079655Link to BLAST:NP_079655.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_079655.1 80 P56393 80 100% 0 0

Chromosomal Locations for CCDS 41096.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome X (NC_000086.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome XSee the combined annotation on chromosome X in Sequence Viewer

Chromosome Start Stop Links
X 106015831 106015870 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 106019579 106019703 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 106021746 106021823 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (243 nt):
ATGTTGCCCTTAGCCAAAAACGCACTAAGCCGTCTCCAAGTTCGAAGCATTCAGCAAGTGGTGGCAAGGC
AG
AGCCACCAGAAGAGGGCACCTAGTTTCCATGACAAATATGGGAATGCTATATTAGCAGGTGGAGCCAT
C
TTCTGTGTTTCTACATGGACATATACAGCCACACAAATTGGAATAGAATGGAACATGTCCCCTGTTGGC
AGA
GTCACCCCAAAGGAATGGAGAGATCAGTAG


Translation (80 aa):
MLPLAKNALSRLQVRSIQQVVARQSHQKRAPSFHDKYGNAILAGGAIFCVSTWTYTATQIGIEWNMSPVG
R
VTPKEWRDQ




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser