NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS23477.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
23477.1 Public Mus musculus 9 Acy1 21 106 86 CCDS HistoryNCBI Gene:109652Re-query CCDS DB by CCDS ID:23477.1Re-query CCDS DB by GeneID:109652See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 23477.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000024031 ENSMUSP00000024031 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000024031Link to Ensembl Protein Viewer:ENSMUSP00000024031Re-query CCDS DB by Nucleotide ID:ENSMUST00000024031Re-query CCDS DB by Protein ID:ENSMUSP00000024031
Original member Current member EBI,WTSI OTTMUST00000125998 OTTMUSP00000068185 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000125998Link to Vega Protein Viewer:OTTMUSP00000068185Re-query CCDS DB by Nucleotide ID:OTTMUST00000125998Re-query CCDS DB by Protein ID:OTTMUSP00000068185
Original member Current member NCBI NM_001276442.1 NP_001263371.1 Accepted alive Link to Nucleotide Sequence:NM_001276442.1Link to Protein Sequence:NP_001263371.1Re-query CCDS DB by Nucleotide ID:NM_001276442Re-query CCDS DB by Protein ID:NP_001263371Link to BLink:NP_001263371.1
Original member Current member NCBI NM_025371.3 NP_079647.1 Accepted alive Link to Nucleotide Sequence:NM_025371.3Link to Protein Sequence:NP_079647.1Re-query CCDS DB by Nucleotide ID:NM_025371Re-query CCDS DB by Protein ID:NP_079647Link to BLink:NP_079647.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001263371.1 408 Q99JW2 408 99.0196% 0 4
NP_079647.1 408 Q99JW2 408 99.0196% 0 4

Chromosomal Locations for CCDS 23477.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 9Link to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 106433081 106433245 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 106433362 106433422 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 106433567 106433646 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 106434530 106434598 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 106434685 106434829 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 106434965 106435014 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 106435096 106435169 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 106435468 106435524 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 106435615 106435704 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 106435784 106435860 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 106436126 106436220 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 106436696 106436800 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 106436889 106436953 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9
9 106437629 106437722 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9Link to Vega Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1227 nt):
ATGACCACCAAGGATCCCGAGTCTGAGCACCCCTCCGTGACGCTCTTCCGCCAGTACCTGCGCATCTGCA
CT
GTGCAACCCAATCCAGACTATGGAGGGGCCATCACCTTCCTGGAGGAGAGAGCCCGCCAGCTGGGTCT
G
AGCTGTCAGAAAATAGAGGTGGTGCCTGGCTTTGTGATCACTGTGCTGACCTGGCCAGGCACCAACCCG
TCA
CTCCCCTCCATCTTGCTAAACTCCCACACAGATGTGGTACCTGTCTTCAAGGAACATTGGCATCACG
AC
CCCTTTGAGGCCTTCAAGGATTCCGAGGGCTACATCTATGCTAGGGGCTCCCAGGACATGAAGAGTGT
C
AGCATCCAGTACCTGGAAGCTGTGAGGAGGCTGAAGAGCGAGGGCCACCGATTCCCTAGGACCATCCAC
ATG
ACCTTTGTGCCTGACGAGGAGGTCGGAGGTCACAAGGGGATGGAGTTGTTTGTGAAGAGGCCTGAGT
TC
CAGGCTCTGCGGGCAGGCTTCGTTCTGGACGAGGGCCTGGCCAACCCCACGGATGCCTTTACTGTCTT
T
TATAGTGAGCGGAGTCCTTGGTGGGTACAGGTTACCAGCACTGGGAAGCCAGGCCATGCCTCACGCTTC
ATT
GAGGATACAGCTGCAGAGAAGTTGCATAAGGTTATAAGCTCCATCTTGGCATTCCGGGAGAAGGAAA
GG
CAGAGGCTGCAGGCGAACCCTCACCTGAAGGAAGGCGCCGTGACTTCGGTGAATCTGACCAAGCTTGA
A
GGTGGCGTGGCCTATAATGTGGTACCTGCCACTATGAGTGCCAGCTTTGACTTCCGAGTGGCACCAGAT
GTA
GACATGAAGGCCTTCGAGAAGCAGCTGCAGAGATGGTGCCAGGAAGCAGGAGAGGGGGTCACCTTTG
AG
TTTGCTCAGAAGTTTACAGAGCCTCGAATGACACCCACGGATGATTCAGATCCCTGGTGGGCAGCTTT
C
AGCGGAGCCTGCAAGGCAATGAACCTCACTCTGGAGCCAGAGATCTTTCCTGCTGCCACTGACAGCCGC
TTT
ATCCGGGCGGTGGGGATCCCAGCTCTGGGCTTCTCGCCCATGAACCGCACACCTGTCCTGCTACATG
AC
CATAATGAACGGCTGCATGAGGATATATTTCTCCGTGGGGTTGACATATATACAGGCCTCCTCTCTGC
A
CTTGCTAGTGTGCCCACCCTGCCTAGTGAAAGCTGA


Translation (408 aa):
MTTKDPESEHPSVTLFRQYLRICTVQPNPDYGGAITFLEERARQLGLSCQKIEVVPGFVITVLTWPGTNP
S
LPSILLNSHTDVVPVFK
EHWHHDPFEAFKDSEGYIYARGSQDMKSVSIQYLEAVRRLKSEGHRFPRTIH
M
TFVP
DEEVGGHKGMELFVKRPEFQALRAGFVLDEGLANPTDAFTVFYSERSPWWVQVTSTGKPGHASRF
I
EDTAAEKL
HKVISSILAFREKERQRLQANPHLKEGAVTSVNLTKLEGGVAYNVVPATMSASFDFRVAPD
V
DMK
AFEKQLQRWCQEAGEGVTFEFAQKFTEPRMTPTDDSDPWWAAFSGACKAMNLTLEPEIFPAATDSR
F
IRA
VGIPALGFSPMNRTPVLLHDHNERLHEDIFLRGVDIYTGLLSALASVPTLPSES



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser