NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS52462.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
52462.1 Public Mus musculus 7 Trpm5 21 106 86 CCDS HistoryNCBI Gene:56843Re-query CCDS DB by CCDS ID:52462.1Re-query CCDS DB by GeneID:56843See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 52462.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000009390 ENSMUSP00000009390 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000009390Link to Ensembl Protein Viewer:ENSMUSP00000009390Re-query CCDS DB by Nucleotide ID:ENSMUST00000009390Re-query CCDS DB by Protein ID:ENSMUSP00000009390
Original member Current member EBI,WTSI OTTMUST00000054375 OTTMUSP00000025953 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000054375Link to Vega Protein Viewer:OTTMUSP00000025953Re-query CCDS DB by Nucleotide ID:OTTMUST00000054375Re-query CCDS DB by Protein ID:OTTMUSP00000025953
Original member Current member NCBI NM_020277.2 NP_064673.2 Accepted alive Link to Nucleotide Sequence:NM_020277.2Link to Protein Sequence:NP_064673.2Re-query CCDS DB by Nucleotide ID:NM_020277Re-query CCDS DB by Protein ID:NP_064673Link to BLink:NP_064673.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_064673.2 1158 Q9JJH7-1 1158 100% 0 0

Chromosomal Locations for CCDS 52462.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 7Link to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 143072348 143072436 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 143072731 143072797 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 143073162 143073234 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 143073969 143074101 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 143074422 143074603 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 143075493 143075646 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 143078292 143078466 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 143079101 143079233 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 143079396 143079514 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 143080116 143080374 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 143080716 143080808 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 143080959 143081071 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 143081747 143081892 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 143082285 143082408 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 143082517 143082657 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 143082723 143083061 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 143083418 143083536 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 143084756 143084858 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 143085118 143085309 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 143085456 143085520 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 143086856 143087042 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 143087701 143087873 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 143088911 143089091 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 143089492 143089608 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3477 nt):
ATGCAAACAACCCAGAGCTCCTGCCCCGGCAGCCCCCCAGATACTGAGGATGGCTGGGAGCCCATCCTAT
GC
AGGGGAGAGATCAACTTCGGAGGGTCTGGGAAGAAGCGAGGCAAGTTTGTGAAGGTGCCAAGCAGTGT
G
GCCCCCTCCGTGCTTTTTGAACTCCTGCTCACCGAGTGGCACCTGCCAGCCCCCAACCTGGTGGTGTCC
CTG
GTGGGTGAGGAACGACCTTTGGCTATGAAGTCGTGGCTTCGGGATGTCCTGCGCAAGGGGCTGGTGA
AA
GCAGCTCAGAGCACAGGTGCCTGGATCCTGACCAGTGCCCTCCACGTGGGCCTGGCCCGCCATGTTGG
A
CAAGCTGTACGTGATCACTCTCTGGCTAGCACATCCACCAAGATCCGTGTAGTGGCCATCGGAATGGCC
TCT
CTGGATCGAATCCTTCACCGTCAACTTCTAGATGGTGTCCACCAAAAGGAGGATACTCCCATCCACT
AC
CCAGCAGATGAGGGCAACATTCAGGGACCCCTCTGCCCCCTGGACAGCAATCTCTCCCACTTCATCCT
T
GTGGAGTCAGGCGCCCTTGGGAGTGGGAACGACGGGCTGACAGAGCTGCAGCTGAGCCTGGAGAAGCAC
ATC
TCTCAGCAGAGGACAGGTTATGGGGGCACCAGCTGCATCCAGATACCTGTCCTTTGCCTGTTGGTCA
AT
GGTGACCCCAACACCCTAGAGAGGATTTCCAGGGCAGTGGAGCAGGCTGCCCCATGGCTGATCCTGGC
A
GGTTCTGGTGGCATTGCTGATGTACTCGCTGCCCTGGTGAGCCAGCCTCATCTCCTGGTGCCCCAGGTG
GCT
GAGAAGCAGTTCAGAGAGAAATTCCCCAGCGAGTGTTTCTCTTGGGAAGCCATTGTACACTGGACAG
AG
CTGTTACAGAACATTGCTGCACACCCCCACCTGCTCACAGTATATGACTTCGAGCAGGAGGGTTCGGA
G
GACCTGGACACTGTCATCCTCAAGGCACTTGTGAAAGCCTGCAAGAGCCACAGCCAAGAAGCCCAAGAC
TAC
CTAGATGAGCTCAAGTTAGCAGTGGCCTGGGATCGCGTGGACATTGCCAAGAGTGAAATCTTCAATG
GG
GACGTGGAATGGAAGTCCTGTGACTTGGAAGAGGTGATGACAGATGCCCTCGTGAGCAACAAGCCTGA
C
TTTGTCCGCCTCTTTGTGGACAGCGGTGCTGACATGGCCGAGTTCTTGACCTATGGGCGGCTGCAGCAG
CTT
TACCATTCTGTGTCCCCCAAGAGCCTCCTCTTTGAACTGCTGCAGCGTAAGCATGAGGAGGGTAGGC
TG
ACACTGGCCGGCCTGGGTGCCCAGCAGGCTCGGGAGCTGCCCATTGGTCTGCCTGCCTTCTCACTCCA
C
GAGGTCTCCCGCGTACTCAAAGACTTCCTGCATGACGCCTGCCGTGGCTTCTACCAGGACGGGCGCAGG
ATG
GAGGAGAGAGGGCCACCTAAGCGGCCCGCAGGCCAGAAGTGGCTGCCAGACCTCAGTAGGAAGAGTG
AA
GACCCTTGGAGGGACCTGTTCCTCTGGGCTGTGCTGCAGAATCGTTATGAGATGGCCACATACTTCTG
G
GCCATGGGCCGGGAGGGTGTGGCTGCTGCTCTGGCTGCCTGCAAGATCATAAAGGAAATGTCCCACCTG
GAG
AAAGAGGCAGAGGTGGCCCGCACCATGCGTGAGGCCAAGTATGAGCAGCTGGCCCTGGATCTTTTCT
CA
GAGTGCTACGGCAACAGTGAGGACCGTGCCTTTGCCCTGCTGGTGCGAAGGAACCACAGCTGGAGCAG
G
ACCACGTGCCTGCACCTGGCCACTGAAGCTGATGCCAAGGCCTTCTTTGCCCATGACGGTGTGCAAGCA
TTC
CTGACCAAGATCTGGTGGGGAGACATGGCCACAGGCACACCCATCCTACGGCTTCTGGGTGCCTTCA
CC
TGCCCAGCCCTCATCTACACAAACCTCATCTCCTTCAGTGAGGATGCCCCGCAGAGGATGGACCTAGA
A
GATCTGCAGGAGCCAGACAGCTTGGATATGGAAAAGAGCTTCCTATGCAGCCGGGGTGGCCAATTGGAG
AAG
CTAACAGAGGCACCAAGGGCTCCAGGCGATCTAGGCCCACAAGCTGCCTTCCTGCTCACACGGTGGA
GG
AAGTTCTGGGGCGCTCCTGTGACTGTGTTCCTGGGGAATGTGGTCATGTACTTCGCATTCCTCTTCCT
G
TTCACCTATGTCCTGCTGGTGGACTTCAGGCCACCACCCCAGGGGCCGTCTGGATCCGAGGTTACCCTC
TAT
TTCTGGGTGTTCACACTGGTGCTGGAGGAAATCCGACAGGGCTTCTTCACAGATGAGGACACGCACC
TG
GTGAAGAAATTCACTCTGTATGTGGAAGACAACTGGAACAAGTGTGACATGGTGGCCATCTTCCTGTT
C
ATTGTGGGAGTCACCTGTAGAATGGTGCCCTCGGTGTTTGAGGCTGGCAGGACCGTTCTGGCCATTGAC
TTC
ATGGTGTTCACACTTCGGCTCATCCACATCTTTGCTATTCACAAGCAGTTGGGTCCTAAGATCATCA
TT
GTAGAGCGAATGATGAAGGATGTCTTCTTTTTCCTCTTCTTCCTGAGCGTATGGCTTGTGGCCTATGG
T
GTGACCACTCAGGCCCTGCTGCATCCCCATGATGGCCGTTTGGAGTGGATTTTCCGCCGTGTGCTATAC
AGG
CCTTACCTGCAGATCTTTGGGCAAATCCCTCTGGATGAAATTGATGAGGCTCGTGTGAACTGTTCTC
TT
CACCCTCTGCTGCTGGAAAGCTCGGCTTCCTGCCCTAATCTCTATGCCAACTGGCTGGTCATTCTCCT
G
CTGGTTACCTTCCTGCTTGTCACTAATGTGCTGCTCATGAACCTTCTGATCGCCATGTTCAGCTACACA
TTC
CAGGTGGTGCAAGGCAATGCAGACATGTTCTGGAAGTTTCAACGCTACCACCTCATCGTTGAATACC
AT
GGAAGACCAGCTCTGGCCCCGCCCTTCATCCTGCTCAGCCACCTGAGCCTGGTGCTCAAGCAGGTCTT
C
AGGAAGGAAGCCCAGCATAAGCGACAACATCTGGAGAGAGACTTGCCTGACCCCTTGGACCAGAAGATC
ATT
ACCTGGGAAACGGTTCAAAAGGAGAACTTCCTGAGTACCATGGAGAAACGGAGGAGGGACAGCGAGG
GG
GAGGTGCTGAGGAAAACGGCACACAGAGTGGACTTGATTGCCAAATACATCGGGGGGCTGAGAGAGCA
A
GAAAAGAGGATCAAGTGTCTGGAATCACAGGCCAACTACTGTATGCTCCTCTTGTCCTCTATGACGGAT
ACA
CTGGCTCCAGGAGGCACCTACTCAAGCTCTCAGAACTGTGGTTGCAGGAGTCAGCCAGCCTCTGCTA
GA
GACAGGGAGTACCTAGAGTCTGGCTTGCCACCCTCTGACACCTGA


Translation (1158 aa):
MQTTQSSCPGSPPDTEDGWEPILCRGEINFGGSGKKRGKFVKVPSSVAPSVLFELLLTEWHLPAPNLVVS
L
VGEERPLAMKSWLRDVLRKGLVKAAQST
GAWILTSALHVGLARHVGQAVRDHSLASTSTKIRVVAIGMA
S
LDRILHRQLLDGVHQK
EDTPIHYPADEGNIQGPLCPLDSNLSHFILVESGALGSGNDGLTELQLSLEKH
I
SQQRTGYG
GTSCIQIPVLCLLVNGDPNTLERISRAVEQAAPWLILAGSGGIADVLAALVSQPHLLVPQV
A
EKQFREKFPSECFSWEAIVHWTEL
LQNIAAHPHLLTVYDFEQEGSEDLDTVILKALVKACKSHSQEAQD
Y
LDELKLAVAWDRVDIAKSEIFNGDVEWK
SCDLEEVMTDALVSNKPDFVRLFVDSGADMAEFLTYGRLQQ
L
YHSVSPKSLLFELLQRKHEEGRLTLAGLGAQQARELPIGLPAFSLHEVSRVLKDFLHDACRGFYQDGRR
M
E
ERGPPKRPAGQKWLPDLSRKSEDPWRDLFLWAVLQNRYEMATYFWAMGREGVAAALAACKIIKEMSHL
E
KEAEVARTMREAKYEQLAL
DLFSECYGNSEDRAFALLVRRNHSWSRTTCLHLATEADAKAFFAHDGVQA
F
LTKIWWGDMATGTPILRLLGAFTCPALIYTNLISF
SEDAPQRMDLEDLQEPDSLDMEKSFLCSRGGQLE
K
LTEAPRAPGDLGPQAAFLLTRWRKFWGAPVTVFLGNVVMYFAFLFLFTYVLLVDFRPPPQGPSGSEVTL
Y
FWVFTLVLEEIRQ
GFFTDEDTHLVKKFTLYVEDNWNKCDMVAIFLFIVGVTCRMVPSVFEAGRTVLAID
F
MVFTLRLIHIFAIHKQLGPKIIIVERM
MKDVFFFLFFLSVWLVAYGVTTQALLHPHDGRLEWIFRRVLY
R
PYLQIFGQIPLDEID
EARVNCSLHPLLLESSASCPNLYANWLVILLLVTFLLVTNVLLMNLLIAMFSYT
F
QVVQGNADMFWKFQRYHLIVEYHGRPALAPPFILLSHLSLVLKQVFRKEAQHKRQHL
ERDLPDPLDQKI
I
TWETVQKENFLSTMEKRRRDSEGEVLRKTAH
RVDLIAKYIGGLREQEKRIKCLESQANYCMLLLSSMTD
T
LAPGGTYS
SSQNCGCRSQPASARDREYLESGLPPSDT



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser