NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS28533.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
28533.1 Public Mus musculus 17 Stub1 21 106 86 CCDS HistoryNCBI Gene:56424Re-query CCDS DB by CCDS ID:28533.1Re-query CCDS DB by GeneID:56424See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 28533.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000044911 ENSMUSP00000040431 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000044911Link to Ensembl Protein Viewer:ENSMUSP00000040431Re-query CCDS DB by Nucleotide ID:ENSMUST00000044911Re-query CCDS DB by Protein ID:ENSMUSP00000040431
Original member Current member NCBI NM_019719.3 NP_062693.1 Accepted alive Link to Nucleotide Sequence:NM_019719.3Link to Protein Sequence:NP_062693.1Re-query CCDS DB by Nucleotide ID:NM_019719Re-query CCDS DB by Protein ID:NP_062693Link to BLink:NP_062693.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_062693.1 304 Q9WUD1 304 100% 0 0

Chromosomal Locations for CCDS 28533.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 17 (NC_000083.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 17Link to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 25830885 25831010 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 25831102 25831218 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 25831309 25831365 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 25831544 25831631 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 25831796 25831961 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 25832046 25832244 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 25832692 25832853 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (915 nt):
ATGAAGGGCAAGGAGGAAAAGGAGGGCGGCGCGCGGCTGGGCACTGGTGGCGGCGGCAGCCCTGATAAGA
GC
CCGAGTGCGCAAGAGCTCAAGGAGCAGGGAAACCGGCTCTTCGTGGGCCGCAAGTACCCGGAGGCGGC
G
GCCTGCTACGGCCGCGCCATCACTCGGAACCCACTTGTGGCAGTGTACTACACTAACCGGGCCCTGTGC
TAT
CTGAAGATGCAGCAGCCTGAACAGGCACTTGCTGACTGCCGGCGAGCCCTGGAGCTGGACGGGCAGT
CT
GTGAAGGCGCACTTCTTCCTGGGGCAGTGCCAGCTGGAGATGGAGAGTTATGATGAGGCCATTGCCAA
T
CTGCAGCGAGCCTATAGTTTGGCCAAGGAGCAGCGACTCAACTTTGGGGATGATATTCCTAGTGCCCTT
CGC
ATTGCTAAGAAGAAGCGCTGGAACAGTATCGAGGAACGGCGCATCCACCAGGAGAGTGAGCTGCATT
CA
TATCTCACCAGGCTCATTGCTGCTGAGCGAGAGAGGGAACTGGAGGAGTGTCAGCGGAACCACGAGGG
T
CATGAAGATGATGGCCACATCCGGGCCCAGCAGGCCTGCATTGAGGCCAAGCACGATAAATACATGGCA
GAT
ATGGATGAGCTCTTCTCTCAGGTGGACGAGAAAAGAAAGAAGCGAGATATCCCTGACTACTTGTGTG
GC
AAGATTAGCTTTGAGCTGATGCGGGAACCCTGCATTACACCCAGTGGTATCACCTATGACCGCAAGGA
C
ATTGAGGAGCACCTGCAGCGTGTGGGCCACTTTGACCCTGTGACCCGGAGCCCTCTGACCCAGGAACAG
CTC
ATCCCCAACTTGGCCATGAAGGAAGTCATTGACGCTTTCATCTCTGAGAACGGCTGGGTAGAGGACT
AT
TGA


Translation (304 aa):
MKGKEEKEGGARLGTGGGGSPDKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALC
Y
LKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQR
AYSLAKEQRLNFGDDIPSAL
R
IAKKKRWNSIEERRIHQESELHSYLTRLIAAERE
RELEECQRNHEGHEDDGHIRAQQACIEAKHDKYMA
D
MDELFSQVDEKRK
KRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQ
L
IPNLAMKEVIDAFISENGWVEDY




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser