NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS21816.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
21816.1 Public Mus musculus 7 Cacng3 21 106 86 CCDS HistoryNCBI Gene:54376Re-query CCDS DB by CCDS ID:21816.1Re-query CCDS DB by GeneID:54376See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 21816.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000084615 ENSMUSP00000081664 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000084615Link to Ensembl Protein Viewer:ENSMUSP00000081664Re-query CCDS DB by Nucleotide ID:ENSMUST00000084615Re-query CCDS DB by Protein ID:ENSMUSP00000081664
Original member Current member EBI,WTSI OTTMUST00000116694 OTTMUSP00000065055 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000116694Link to Vega Protein Viewer:OTTMUSP00000065055Re-query CCDS DB by Nucleotide ID:OTTMUST00000116694Re-query CCDS DB by Protein ID:OTTMUSP00000065055
Original member Current member NCBI NM_019430.2 NP_062303.2 Accepted alive Link to Nucleotide Sequence:NM_019430.2Link to Protein Sequence:NP_062303.2Re-query CCDS DB by Nucleotide ID:NM_019430Re-query CCDS DB by Protein ID:NP_062303Link to BLink:NP_062303.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_062303.2 315 Q9JJV5 315 100% 0 0

Chromosomal Locations for CCDS 21816.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 7Link to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 122671774 122671984 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 122754506 122754589 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 122762183 122762323 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 122768335 122768846 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (948 nt):
ATGAGGATGTGTGACAGAGGTATCCAGATGTTGATCACTACTGTAGGAGCCTTCGCAGCTTTTAGTTTAA
TG
ACCATTGCAGTGGGCACGGACTACTGGCTATATTCCAGAGGTGTGTGCAGGACTAAATCTACAAGTGA
C
AATGAAACCAGCAGGAAGAATGAAGAAGTAATGACCCACTCCGGGTTGTGGAGGACCTGCTGCTTGGAA
G
GA
GCTTTCCGAGGCGTGTGCAAGAAAATCGATCACTTCCCAGAAGATGCAGACTATGAACAGGATACAG
CA
GAATATCTTCTACGAGCTGTGAGGGCCTCCAGCGTCTTTCCCATCCTCAGCGTCACTCTGCTGTTTTT
C
GGGGGACTCTGCGTGGCTGCCAGCGAGTTCCACCGCAGCAGGCACAGTGTGATCCTCAGCGCTGGCATC
TTC
TTCGTCTCTGCAGGGCTAAGCAACATCATCGGCATCATAGTTTATATCTCAGCCAATGCTGGAGACC
CT
GGGCAGAGGGACTCTAAAAAGAGCTACTCCTACGGCTGGTCCTTTTATTTTGGAGCCTTCTCTTTCAT
C
ATCGCGGAAATTGTGGGCGTGGTCGCCGTGCACATCTATATCGAGAAGCATCAGCAGTTGCGTGCCAGA
TCC
CATTCAGAGCTCCTGAAGAAGTCTACATTTGCGCGCCTGCCGCCCTACAGGTATAGATTCCGAAGAC
GG
TCAAGTTCTCGCTCCACTGAACCCAGATCTCGAGACCTTTCTCCCATCAGCAAAGGCTTCCACACCAT
C
CCTTCCACCGACATCTCCATGTTCACCCTCTCCCGGGACCCCTCTAAGCTTACCATGGGGACCCTTCTC
AAC
TCTGACCGGGACCATGCTTTTCTACAGTTCCACAACTCCACACCCAAAGAGTTCAAAGAGTCATTGC
AT
AACAATCCGGCCAACAGACGTACCACGCCTGTCTGA


Translation (315 aa):
MRMCDRGIQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCRTKSTSDNETSRKNEEVMTHSGLWRTCCLE
G
AFRGVCKKIDHFPEDADYEQDTAEYLLRAVRASSVFPILSVTLLFFGGLCVAASEFHRSRHSVILSAGI
F
FVSA
GLSNIIGIIVYISANAGDPGQRDSKKSYSYGWSFYFGAFSFIIAEIVGVVAVHIYIEKHQQLRAR
S
HSELLKKSTFARLPPYRYRFRRRSSSRSTEPRSRDLSPISKGFHTIPSTDISMFTLSRDPSKLTMGTLL
N
SDRDHAFLQFHNSTPKEFKESLHNNPANRRTTPV




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser