NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS30178.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
30178.1 Public Mus musculus X Mtmr1 21 106 86 CCDS HistoryNCBI Gene:53332Re-query CCDS DB by CCDS ID:30178.1Re-query CCDS DB by GeneID:53332See the combined annotation on chromosome X in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 30178.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000015358 ENSMUSP00000015358 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000015358Link to Ensembl Protein Viewer:ENSMUSP00000015358Re-query CCDS DB by Nucleotide ID:ENSMUST00000015358Re-query CCDS DB by Protein ID:ENSMUSP00000015358
Original member Current member NCBI NM_016985.2 NP_058681.1 Accepted alive Link to Nucleotide Sequence:NM_016985.2Link to Protein Sequence:NP_058681.1Re-query CCDS DB by Nucleotide ID:NM_016985Re-query CCDS DB by Protein ID:NP_058681Link to BLink:NP_058681.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_058681.1 669 Q9Z2C4 669 100% 0 0

Chromosomal Locations for CCDS 30178.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome X (NC_000086.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome XLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XSee the combined annotation on chromosome X in Sequence Viewer

Chromosome Start Stop Links
X 71364915 71365072 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71369799 71369904 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71383200 71383275 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71388223 71388317 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71388653 71388760 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71391690 71391791 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71392516 71392599 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71393296 71393445 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71394277 71394465 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71400541 71400726 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71401728 71401934 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71404872 71404964 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71410733 71410846 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71412205 71412381 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71416563 71416727 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2010 nt):
ATGGACAGGCCAGTGGCGGCGGCGGCCGCCGCATCTGCGGCGAGCTGCGAGGGCGCTGGGGGCCCGGGGC
CA
GGGCCGGGCGCTAGCTGGAGACCCTCTCGGGTTGCGGGGGGCGCCTCGGCCAGCTCCCGGCACCCCAG
C
ATTGAGACCCTTGACAGTCCTACAGGGTCACATGTTGAATGGTGTAAACAGCTTATAGCTGCTACAATT
TCT
AGTCAGATTTCAGGTTCAGTGACATCAGAAAATGTGTCAAGAGATTACAAGGCTCTAAGGGATGGAA
AT
AAACTGGCACAGATGGAAGAAGCTCCACTTTTCCCAGGAGAATCAATTAAGGCCATTGTGAAAGACGT
C
ATTTATATCTGTCCATTTATGGGAGCAGTGAGTGGGACCCTGACAGTGACGGACTTTAAAATGTACTTC
AAA
AATGTAGAAAGGGACCCACATTTCGTCCTTGATGTTCCTCTTGGAGTGATCAGCAGAGTGGAGAAGA
TT
GGTGCACAGAGCCATGGGGATAATTCTTGTGGTATAGAGATTGTGTGCAAGGATATGAGGAACCTGAG
A
CTTGCATATAAGCAGGAAGAACAGCGAAAACTTGGGATATTTGAAAACCTCAACAAGCATGCTTTTCCT
CTT
TCCAATGGGCAGGTGCTATTTGCATTCAACTATAAAGAAAAGTTTCCAGTTAATGGCTGGAAAGTTT
AT
GATCCAGTGTCTGAATATAAGAGACAGGGCTTGCCAAATGAGAGTTGGAAAATATCAAAAATAAACAG
T
AATTATGAGTTCTGTGATACCTATCCTGCCATCATTGTTGTGCCAACTAGTGTGAAAGATGATGACCTT
TCA
AAAGTGGCAGCCTTTCGAGCGAAAGGCAGAGTCCCTGTGTTGTCATGGATTCACCCAGAAAGTCAGG
CA
ACAATTACACGTTGCAGCCAGCCATTAGTGGGTCCCAATGATAAACGCTGCAAAGAAGATGAGAAATA
C
CTGCAGACAATAATGGATGCTAATGCACAGTCACATAAACTTACTATCTTTGATGCCAGACAAAACAGC
GTT
GCTGATACCAACAAGGCAAAGGGTGGTGGATATGAAAATGAAAGTGCTTACCCTAATGCCGAACTCA
TA
TTCTTGGAGATCCACAATATTCATGTGATGAGGGAGTCACTTCGTAAATTAAAGGAGATTGTGTATCC
T
TCAATTGATGAGTCACATTGGCTATCCAATGTGGATGGGACACATTGGCTGGAATATATACGGGTTCTC
CTT
GCTGGGGCAGTGAGAATTGCTGATAAAATAGAATCTGGGAAAACTTCCGTGGTCATCCACTGCAGTG
AT
GGGTGGGATCGAACATCCCAGCTCACATCTCTGGCAATGCTGATGTTAGACAGTTATTACCGGACCAT
T
AAAGGATTTGAGGCTCTCATAGAAAAGGAGTGGATAAGCTTTGGACACAGGTTTGCCCTGAGAGTGGGC
CAT
GGTGATGACAACCATGCAGATGCTGACCGATCACCTATATTTCTTCAGTTTATTGATTGTGTTTGGC
AG
ATGACAAGACAGTTCCCTTCAGCATTTGAGTTTAATGAATTATTCTTGATTACAATTTTGGATCACCT
C
TATAGTTGTCTTTTTGGGACCTTTTTGTGCAACTGTGAACAACAGCGAATCAAAGAGGATGTATATACA
AAT
ACTATATCTTTATGGTCTTATATCAATAGCCAACTAGATGAATTCTCAAATCCCTTCTTTGTGAATT
AT
GAGAACCATGTGTTATATCCTGTTGCTAGTATGAGTCACTTGGAATTGTGGGTAAATTATTATGTACG
G
TGGAATCCACGGATGAGACCACAGATGCCAATTCATCAGAATCTCAAGGAACTGCTGGCTATCAAGGCT
GAG
CTGCAGAAGCGTGTGGAGGACTTGCAGCGGGAGATGGCCACCCGGACCATCTCATCTTCCTCTGAGA
GG
GGCTCCTCACCTACCCACTCAGCTACTCCTGTACACACCTCAGTCTGA


Translation (669 aa):
MDRPVAAAAAASAASCEGAGGPGPGPGASWRPSRVAGGASASSRHPSIETLDSPTGSHVEWCKQLIAATI
S
SQISGSVTSENVSRDYK
ALRDGNKLAQMEEAPLFPGESIKAIVKDVIYICPFMGAVSGTLTVTDFKMYF
K
NVER
DPHFVLDVPLGVISRVEKIGAQSHGDNSCGIEIVCKDMRNLRLAYKQEEQRKLGIFENLNKHAFP
L
SNGQ
VLFAFNYKEKFPVNGWKVYDPVSEYKRQGLPNESWKISKINSNYEFCDTYPAIIVVPTSVKDDDL
S
KVAAFRAKGRVP
VLSWIHPESQATITRCSQPLVGPNDKRCKEDEKYLQTIMDANAQSHKLTIFDARQNS
V
ADTNK
AKGGGYENESAYPNAELIFLEIHNIHVMRESLRKLKEIVYPSIDESHWLSNVDGTHWLEYIRVL
L
AGAVRIADKIESGKTSVVIHCSDGWDRTSQLTSLAMLMLDSYYRTIKGFEALIEKEWISFGHRFAL
RVG
H
GDDNHADADRSPIFLQFIDCVWQMTRQ
FPSAFEFNELFLITILDHLYSCLFGTFLCNCEQQRIKEDVYT
N
TISLWSYINSQLDEFSNPFFVNYENHVLYPVASMSHLELWVNYYVRWNPRMRPQ
MPIHQNLKELLAIKA
E
LQKRVEDLQREMATRTISSSSERGSSPTHSATPVHTSV




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser