NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS28575.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
28575.1 Public Mus musculus 17 Ppard 21 106 86 CCDS HistoryNCBI Gene:19015Re-query CCDS DB by CCDS ID:28575.1Re-query CCDS DB by GeneID:19015See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 28575.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000002320 ENSMUSP00000002320 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000002320Link to Ensembl Protein Viewer:ENSMUSP00000002320Re-query CCDS DB by Nucleotide ID:ENSMUST00000002320Re-query CCDS DB by Protein ID:ENSMUSP00000002320
Original member Current member EBI,WTSI OTTMUST00000056745 OTTMUSP00000027308 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000056745Link to Vega Protein Viewer:OTTMUSP00000027308Re-query CCDS DB by Nucleotide ID:OTTMUST00000056745Re-query CCDS DB by Protein ID:OTTMUSP00000027308
Original member Current member NCBI NM_011145.3 NP_035275.1 Accepted alive Link to Nucleotide Sequence:NM_011145.3Link to Protein Sequence:NP_035275.1Re-query CCDS DB by Nucleotide ID:NM_011145Re-query CCDS DB by Protein ID:NP_035275Link to BLAST:NP_035275.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_035275.1 440 P35396 440 100% 0 0

Chromosomal Locations for CCDS 28575.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 17 (NC_000083.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 17Link to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 28286341 28286467 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 28295341 28295495 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 28297086 28297224 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 28298277 28298479 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 28298584 28299034 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 28299602 28299849 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1323 nt):
ATGGAACAGCCACAGGAGGAGACCCCTGAGGCCCGGGAAGAGGAGAAAGAGGAAGTGGCCATGGGTGACG
GA
GCCCCGGAGCTCAATGGGGGACCAGAACACACGCTTCCTTCCAGCAGCTGTGCAGACCTCTCCCAGAA
T
TCCTCCCCTTCCTCCCTGCTGGACCAGCTGCAGATGGGCTGTGATGGGGCCTCAGGCGGCAGCCTCAAC
ATG
GAATGTCGGGTGTGCGGGGACAAGGCCTCGGGCTTCCACTACGGGGTCCACGCGTGCGAGGGGTGCA
AG
GGCTTCTTCCGCCGGACAATCCGCATGAAGCTCGAGTATGAGAAGTGCGATCGGATCTGCAAGATCCA
G
AAGAAGAACCGCAACAAGTGTCAGTACTGCCGCTTCCAGAAGTGCCTGGCACTCGGCATGTCGCACAAC
G
CT
ATCCGCTTTGGACGGATGCCGGAGGCCGAGAAGAGGAAGCTGGTGGCGGGGCTGACTGCCAGCGAGG
GG
TGCCAGCACAACCCCCAGCTGGCCGACCTGAAGGCCTTCTCTAAGCACATCTACAACGCCTACCTGAA
A
AACTTCAACATGACCAAAAAGAAGGCCCGGAGCATCCTCACCGGCAAGTCCAGCCACAACGCACCCTTT
GTC
ATCCACGACATCGAGACACTGTGGCAGGCAGAGAAGGGCCTGGTGTGGAAACAGCTGGTGAACGGGC
TG
CCGCCCTACAACGAGATCAGTGTGCACGTGTTCTACCGCTGCCAGTCCACCACAGTGGAGACAGTCCG
A
GAGCTCACCGAGTTCGCCAAGAACATCCCCAACTTCAGCAGCCTCTTCCTCAATGACCAGGTGACCCTC
CTC
AAGTATGGCGTGCACGAGGCCATCTTTGCCATGCTGGCCTCCATCGTCAACAAAGACGGGCTGCTGG
TG
GCCAACGGCAGTGGCTTCGTCACCCACGAGTTCTTGCGAAGTCTCCGCAAGCCCTTCAGTGACATCAT
T
GAGCCCAAGTTCGAGTTTGCTGTCAAGTTCAATGCGCTGGAGCTCGATGACAGTGACCTGGCGCTCTTC
ATC
GCGGCCATCATTCTGTGTGGAGACCGGCCAGGCCTCATGAATGTGCCCCAGGTAGAAGCCATCCAGG
AC
ACCATTCTGCGGGCTCTAGAATTCCATCTGCAGGTCAACCACCCTGACAGCCAGTACCTCTTCCCCAA
G
CTGCTGCAGAAGATGGCAGACCTGCGGCAGCTGGTCACTGAGCATGCCCAGATGATGCAGTGGCTAAAG
AAG
ACGGAGAGTGAGACCTTGCTGCACCCCCTGCTCCAGGAAATCTACAAGGACATGTACTAA


Translation (440 aa):
MEQPQEETPEAREEEKEEVAMGDGAPELNGGPEHTLPSSSCADLSQNSSPSSLLDQLQMGCDGASGGSLN
M
ECRVCGDKASGFHYGVHACEGCK
GFFRRTIRMKLEYEKCDRICKIQKKNRNKCQYCRFQKCLALGMSHN
A
IRFGRMPEAEKRKLVAGLTASEGCQHNPQLADLKAFSKHIYNAYLKNFNMTKKKARSILTGKSSHNAPF
V
IHDIETLWQAEKGLVWKQLVNGLPPYNEISVHVFYRCQSTTVETVRELTEFAKNIPNFSSLFLNDQVTL
L
KYGVHEAIFAMLASIVNKDGLLVANGSGFVTHEFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALF
I
AAIILCG
DRPGLMNVPQVEAIQDTILRALEFHLQVNHPDSQYLFPKLLQKMADLRQLVTEHAQMMQWLK
K
TESETLLHPLLQEIYKDMY




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser