NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS23623.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
23623.1 Public Mus musculus 9 Rpsa 21 106 86 CCDS HistoryNCBI Gene:16785Re-query CCDS DB by CCDS ID:23623.1Re-query CCDS DB by GeneID:16785See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 23623.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000035105 ENSMUSP00000035105 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000035105Link to Ensembl Protein Viewer:ENSMUSP00000035105Re-query CCDS DB by Nucleotide ID:ENSMUST00000035105Re-query CCDS DB by Protein ID:ENSMUSP00000035105
Original member Current member NCBI NM_011029.4 NP_035159.3 Accepted alive Link to Nucleotide Sequence:NM_011029.4Link to Protein Sequence:NP_035159.3Re-query CCDS DB by Nucleotide ID:NM_011029Re-query CCDS DB by Protein ID:NP_035159Link to BLink:NP_035159.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_035159.3 295 P14206 295 100% 0 0

Chromosomal Locations for CCDS 23623.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 9Link to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 120128490 120128622 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 120129158 120129276 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 120130118 120130363 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 120130768 120130896 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 120131000 120131165 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 120131400 120131494 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (888 nt):
ATGTCCGGAGCCCTTGACGTCCTGCAGATGAAGGAGGAGGATGTCCTCAAATTCCTTGCTGCGGGAACCC
AC
TTAGGTGGCACCAACCTTGACTTTCAGATGGAGCAGTACATCTACAAAAGGAAAAGTGACGGTATCTA
C
ATCATAAACCTGAAGAGGACCTGGGAGAAGCTGTTGCTCGCAGCTCGAGCTATTGTTGCCATCGAGAAT
CCT
GCTGACGTCAGCGTCATCTCCTCCAGGAACACTGGCCAGCGAGCTGTGCTGAAGTTTGCTGCTGCCA
CA
GGAGCCACTCCGATCGCTGGCCGCTTCACACCTGGGACCTTCACTAACCAGATCCAAGCAGCCTTCAG
G
GAGCCACGGCTTCTAGTGGTGACCGATCCCAGGGCTGACCATCAGCCACTCACAGAGGCCTCTTATGTC
AAC
CTGCCCACCATTGCTCTGTGTAACACAGATTCTCCCCTGCGCTATGTGGACATTGCCATCCCATGCA
AC
AACAAGGGAGCTCACTCAGTGGGTCTGATGTGGTGGATGCTGGCCAGGGAAGTACTCCGCATGCGAGG
T
ACTATCTCCCGTGAGCACCCCTGGGAGGTCATGCCTGATCTTTACTTCTACAGAGACCCAGAGGAGATT
GAG
AAGGAGGAGCAGGCTGCTGCTGAGAAGGCTGTGACCAAGGAGGAATTCCAGGGTGAATGGACCGCAC
CA
GCTCCTGAGTTCACTGCTGCTCAGCCTGAGGTGGCCGACTGGTCTGAGGGTGTGCAGGTTCCCTCTGT
G
CCCATCCAGCAGTTCCCCACGGAAGACTGGAGTGCACAGCCAGCCACTGAGGATTGGTCAGCAGCTCCC
ACA
GCGCAGGCCACTGAGTGGGTTGGAGCCACCACTGAGTGGTCCTGA


Translation (295 aa):
MSGALDVLQMKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKLLLAARAIVAIEN
P
ADVSVISSRNTGQ
RAVLKFAAATGATPIAGRFTPGTFTNQIQAAFREPRLLVVTDPRADHQPLTEASYV
N
LPTIALCNTDSPLRYVDIAIPCNNK
GAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEEI
E
KEEQAAAEKAVTKEEFQGEWTAPAPEFTAAQPEVADWSEGVQVPSVPIQQFPT
EDWSAQPATEDWSAAP
T
AQATEWVGATTEWS




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser