NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS15806.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
15806.1 Public Mus musculus 2 Notch1 21 106 86 CCDS HistoryNCBI Gene:18128Re-query CCDS DB by CCDS ID:15806.1Re-query CCDS DB by GeneID:18128See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 15806.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000028288 ENSMUSP00000028288 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000028288Link to Ensembl Protein Viewer:ENSMUSP00000028288Re-query CCDS DB by Nucleotide ID:ENSMUST00000028288Re-query CCDS DB by Protein ID:ENSMUSP00000028288
Original member Current member EBI,WTSI OTTMUST00000030656 OTTMUSP00000013754 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000030656Link to Vega Protein Viewer:OTTMUSP00000013754Re-query CCDS DB by Nucleotide ID:OTTMUST00000030656Re-query CCDS DB by Protein ID:OTTMUSP00000013754
Original member Current member NCBI NM_008714.3 NP_032740.3 Accepted alive Link to Nucleotide Sequence:NM_008714.3Link to Protein Sequence:NP_032740.3Re-query CCDS DB by Nucleotide ID:NM_008714Re-query CCDS DB by Protein ID:NP_032740Link to BLAST:NP_032740.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_032740.3 2531 Q01705-1 2531 100% 0 0

Chromosomal Locations for CCDS 15806.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 26459531 26460976 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 26462148 26462245 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 26462342 26462489 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 26463710 26464005 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 26464806 26464971 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 26465063 26465150 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 26465350 26465566 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 26466467 26466615 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 26467629 26468030 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 26468232 26468803 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 26469605 26469717 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 26469801 26470058 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 26470274 26470406 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 26470822 26471006 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 26471152 26471305 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 26472071 26472272 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 26472784 26473012 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 26473681 26473833 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 26474121 26474240 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 26476074 26476187 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 26476348 26476493 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 26476947 26477139 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 26477880 26477990 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 26478070 26478303 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 26478607 26478720 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 26479447 26479560 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 26479871 26480056 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 26480224 26480379 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 26480974 26481207 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 26481571 26481693 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 26484268 26484606 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 26485187 26485449 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 26501881 26501959 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 26503498 26503558 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (7596 nt):
ATGCCACGGCTCCTGACGCCCTTGCTCTGCCTAACGCTGCTGCCCGCGCTCGCCGCAAGAGGCTTGAGAT
GC
TCCCAGCCAAGTGGGACCTGCCTGAATGGAGGGAGGTGCGAAGTGGCCAACGGCACTGAAGCCTGTGT
C
TGCAGCGGAGCCTTTGTGGGCCAACGATGCCAGGACTCCAATCCTTGCCTCAGCACACCGTGTAAGAAT
GCT
GGAACGTGCCACGTTGTGGACCATGGTGGCACTGTGGATTATGCCTGCAGCTGTCCCCTGGGTTTCT
CT
GGGCCCCTCTGCCTGACACCTCTGGACAACGCCTGCCTGGCCAACCCCTGCCGCAATGGGGGCACCTG
T
GACCTGCTCACTCTCACAGAGTACAAGTGCCGCTGCCCACCAGGGTGGTCAGGAAAATCATGTCAGCAG
GCT
GACCCCTGTGCCTCCAACCCCTGTGCCAATGGTGGCCAGTGCCTGCCCTTTGAGTCTTCATACATCT
GT
CGCTGCCCGCCTGGCTTCCATGGCCCCACCTGCAGGCAAGATGTTAATGAGTGCAGCCAGAACCCTGG
G
CTGTGCCGCCATGGAGGCACCTGCCACAATGAGATCGGCTCCTATCGCTGTGCCTGCCGTGCCACCCAT
ACT
GGTCCCCACTGTGAACTGCCCTATGTGCCCTGCAGCCCCTCACCCTGCCAGAATGGAGGCACCTGCC
GT
CCTACAGGGGACACCACCCACGAGTGTGCCTGCTTGCCAGGTTTTGCTGGACAGAACTGTGAAGAAAA
T
GTGGATGACTGTCCAGGAAACAACTGCAAGAATGGGGGTGCCTGTGTGGACGGCGTGAATACCTACAAT
TGC
CGCTGCCCACCGGAGTGGACGGGTCAGTACTGTACAGAGGATGTGGACGAATGTCAGCTCATGCCCA
AT
GCCTGCCAGAATGGCGGAACCTGCCACAACACACACGGCGGCTACAACTGTGTGTGTGTCAATGGGTG
G
ACTGGCGAGGACTGCAGTGAGAACATTGATGACTGTGCCAGTGCCGCCTGTTTCCAGGGTGCCACTTGC
CAC
GACCGTGTGGCTTCCTTCTACTGCGAATGTCCGCATGGGCGCACAGGTCTGCTGTGCCACCTCAACG
AT
GCGTGCATCAGCAACCCCTGCAACGAGGGCTCCAACTGTGACACCAACCCTGTCAACGGCAAAGCCAT
C
TGCACCTGCCCCTCGGGGTACACAGGGCCAGCCTGCAGCCAGGACGTGGATGAGTGTGCTCTGGGTGCC
AAC
CCTTGTGAGCACGCAGGCAAATGCCTCAACACACTGGGTTCTTTTGAGTGCCAGTGTCTACAGGGCT
AC
ACGGGACCCCGCTGTGAGATTGATGTTAATGAGTGCATCTCCAACCCATGTCAGAATGATGCCACTTG
C
CTGGACCAGATTGGGGAGTTCCAATGCATATGTATGCCAGGTTATGAAGGTGTATACTGTGAAATCAAC
ACG
GATGAGTGCGCCAGCAGCCCCTGTCTGCACAATGGCCACTGCATGGACAAGATCAATGAGTTCCAAT
GT
CAGTGCCCCAAAGGCTTCAACGGGCACCTGTGCCAGTATGATGTGGATGAGTGTGCCAGCACACCATG
C
AAGAACGGTGCCAAGTGCCTGGATGGGCCCAACACCTATACCTGCGTGTGTACAGAAGGTTACACAGGG
ACC
CACTGCGAAGTGGACATTGACGAGTGTGACCCTGACCCCTGCCACTATGGTTCCTGTAAGGATGGTG
TG
GCCACCTTTACCTGCCTGTGCCAGCCAGGCTACACAGGCCATCACTGTGAGACCAACATCAATGAGTG
C
CACAGCCAACCGTGCCGCCATGGGGGCACCTGCCAGGACCGTGACAACTCCTACCTCTGCTTATGCCTC
AAG
GGAACCACAGGGCCCAACTGTGAGATCAACCTGGATGACTGCGCCAGCAACCCCTGTGACTCTGGCA
CC
TGTCTGGACAAGATTGATGGCTACGAATGTGCCTGTGAACCAGGCTACACAGGAAGCATGTGTAACGT
C
AACATTGACGAATGTGCGGGCAGCCCCTGCCACAACGGGGGCACTTGTGAGGATGGCATCGCGGGCTTC
ACT
TGCCGCTGCCCCGAGGGCTACCATGACCCCACGTGCCTGTCCGAGGTCAACGAGTGCAACAGTAACC
CC
TGCATCCACGGAGCTTGCCGGGATGGCCTCAATGGGTACAAGTGTGACTGTGCCCCTGGGTGGAGTGG
A
ACAAACTGTGACATCAACAACAACGAGTGTGAGTCCAACCCTTGTGTCAACGGTGGCACCTGCAAGGAC
ATG
ACCAGTGGCTACGTATGCACCTGCCGAGAAGGCTTCAGTGGCCCTAATTGCCAGACCAACATCAACG
AA
TGTGCCTCCAACCCCTGCCTGAACCAGGGGACCTGCATTGATGATGTCGCTGGATACAAGTGCAACTG
T
CCTCTGCCATATACAGGAGCCACGTGTGAGGTGGTGTTGGCCCCATGTGCTACCAGCCCCTGCAAAAAC
AGC
GGGGTATGCAAGGAGTCTGAAGACTATGAGAGTTTTTCCTGTGTCTGTCCCACAGGCTGGCAAGGTC
AA
ACCTGCGAGGTTGACATCAATGAGTGTGTGAAAAGCCCATGTCGCCATGGGGCCTCCTGCCAGAACAC
C
AATGGCAGCTACCGCTGCCTCTGCCAGGCCGGCTATACAGGTCGCAACTGTGAGAGTGACATCGATGAC
TGC
CGCCCCAACCCGTGTCACAATGGGGGTTCCTGCACCGATGGCATCAACACAGCCTTCTGCGACTGCC
TG
CCCGGCTTCCAGGGTGCCTTCTGTGAGGAGGACATCAATGAATGTGCCAGCAATCCCTGCCAAAATGG
T
GCCAATTGCACTGACTGTGTGGACAGCTACACATGTACCTGCCCCGTGGGCTTCAATGGCATCCACTGC
GAG
AACAACACACCTGACTGTACTGAGAGCTCCTGCTTCAATGGTGGTACCTGTGTGGATGGTATCAACT
CC
TTCACCTGTCTGTGTCCACCTGGCTTCACGGGCAGCTACTGTCAGTATGATGTCAATGAGTGTGATTC
A
CGGCCCTGTCTGCACGGTGGTACCTGCCAAGACAGCTATGGTACTTATAAGTGTACCTGCCCACAGGGC
TAC
ACTGGTCTCAACTGCCAGAACCTTGTGCGCTGGTGCGACTCGGCTCCCTGCAAGAATGGTGGCAGGT
GC
TGGCAGACCAACACGCAGTACCACTGTGAGTGCCGCAGCGGCTGGACTGGCGTCAACTGCGACGTGCT
C
AGTGTGTCCTGTGAGGTGGCTGCACAGAAGCGAGGCATTGACGTCACTCTCCTGTGCCAGCATGGAGGG
CTC
TGTGTGGATGAGGGAGATAAACATTACTGCCACTGCCAGGCAGGCTACACGGGCAGCTACTGTGAGG
AC
GAGGTGGACGAGTGCTCACCTAACCCCTGCCAGAATGGAGCTACCTGCACTGACTATCTCGGCGGCTT
T
TCCTGCAAGTGTGTGGCTGGCTACCATGGGTCTAACTGCTCCGAGGAGATCAACGAGTGCCTGTCCCAG
CCC
TGCCAGAATGGGGGTACCTGCATTGATCTGACCAACTCCTACAAGTGTTCCTGCCCCCGGGGGACAC
AG
GGTGTACACTGTGAGATCAATGTTGATGACTGCCATCCCCCCCTTGACCCTGCCTCCCGAAGCCCCAA
G
TGCTTCAACAATGGCACCTGTGTGGACCAGGTGGGTGGCTATACCTGCACCTGCCCACCAGGCTTCGTC
GGG
GAGCGGTGTGAGGGTGATGTCAATGAATGTCTCTCCAACCCCTGTGACCCACGTGGCACCCAGAACT
GT
GTGCAGCGTGTTAATGACTTCCACTGCGAGTGCCGGGCTGGCCACACTGGACGCCGCTGTGAGTCAGT
C
ATCAATGGCTGCAGGGGCAAACCTTGCAAGAATGGGGGTGTCTGTGCCGTGGCCTCCAACACCGCCCGT
GGA
TTCATCTGTAGGTGCCCTGCGGGCTTCGAGGGTGCCACATGTGAGAATGATGCCCGCACTTGTGGCA
GC
TTACGCTGCCTCAACGGTGGTACATGCATCTCGGGCCCACGTAGTCCCACCTGCCTATGCCTGGGATC
C
TTCACCGGCCCTGAGTGCCAGTTCCCAGCCAGCAGCCCCTGTGTGGGTAGCAACCCCTGCTACAATCAG
GGC
ACCTGTGAGCCCACATCCGAGAACCCTTTCTACCGCTGTCTATGCCCTGCCAAATTCAACGGGCTAC
TG
TGCCACATCCTGGACTACAGCTTCACAGGTGGCGCTGGGCGCGACATTCCCCCACCGCAGATTGAGGA
G
GCCTGTGAGCTGCCTGAGTGCCAGGTGGATGCAGGCAATAAGGTCTGCAACCTGCAGTGTAATAATCAC
GCA
TGTGGCTGGGATGGTGGCGACTGCTCCCTCAACTTCAATGACCCCTGGAAGAACTGCACGCAGTCTC
TA
CAGTGCTGGAAGTATTTTAGCGACGGCCACTGTGACAGCCAGTGCAACTCGGCCGGCTGCCTCTTTGA
T
GGCTTCGACTGCCAGCTCACCGAGGGACAGTGCAACCCCCTGTATGACCAGTACTGCAAGGACCACTTC
AGT
GATGGCCACTGCGACCAGGGCTGTAACAGTGCCGAATGTGAGTGGGATGGCCTAGACTGTGCTGAGC
AT
GTACCCGAGCGGCTGGCAGCCGGCACCCTGGTGCTGGTGGTGCTGCTTCCACCCGACCAGCTACGGAA
C
AACTCCTTCCACTTTCTGCGGGAGCTCAGCCACGTGCTGCACACCAACGTGGTCTTCAAGCGTGATGCG
CAA
GGCCAGCAGATGATCTTCCCGTACTATGGCCACGAGGAAGAGCTGCGCAAGCACCCAATCAAGCGCT
CT
ACAGTGGGTTGGGCCACCTCTTCACTGCTTCCTGGTACCAGTGGTGGGCGCCAGCGCAGGGAGCTGGA
C
CCCATGGACATCCGTGGCTCCATTGTCTACCTGGAGATCGACAACCGGCAATGTGTGCAGTCATCCTCG
CAG
TGCTTCCAGAGTGCCACCGATGTGGCTGCCTTCCTAGGTGCTCTTGCGTCACTTGGCAGCCTCAATA
TT
CCTTACAAGATTGAGGCCGTGAAGAGTGAGCCGGTGGAGCCTCCGCTGCCCTCGCAGCTGCACCTCAT
G
TACGTGGCAGCGGCCGCCTTCGTGCTCCTGTTCTTTGTGGGCTGTGGGGTGCTGCTGTCCCGCAAGCGC
CGG
CGGCAGCATGGCCAGCTCTGGTTCCCTGAGGGTTTCAAAGTGTCAGAGGCCAGCAAGAAGAAGCGGA
GA
GAGCCCCTCGGCGAGGACTCAGTCGGCCTCAAGCCCCTGAAGAATGCCTCAGATGGTGCTCTGATGGA
C
GACAATCAGAACGAGTGGGGAGACGAAGACCTGGAGACCAAGAAGTTCCGGTTTGAGGAGCCAGTAGTT
CTC
CCTGACCTGAGTGATCAGACTGACCACAGGCAGTGGACCCAGCAGCACCTGGACGCTGCTGACCTGC
GC
ATGTCTGCCATGGCCCCAACACCGCCTCAGGGGGAGGTGGATGCTGACTGCATGGATGTCAATGTTCG
A
GGACCAGATGGCTTCACACCCCTCATGATTGCCTCCTGCAGTGGAGGGGGCCTTGAGACAGGCAACAGT
GAA
GAAGAAGAAGATGCACCTGCTGTCATCTCTGACTTCATCTACCAGGGCGCCAGCTTGCACAACCAGA
CA
GACCGCACCGGGGAGACCGCCTTGCACTTGGCTGCCCGATACTCTCGTTCAGATGCTGCAAAGCGCTT
G
CTGGAGGCCAGTGCAGATGCCAACATCCAGGACAACATGGGCCGTACTCCGTTACATGCAGCAGTTTCT
GCA
GATGCTCAGGGTGTCTTCCAGATCCTGCTCCGGAACAGGGCCACAGATCTGGATGCCCGAATGCATG
AT
GGCACAACTCCACTGATCCTGGCTGCGCGCCTGGCCGTGGAGGGCATGCTGGAGGACCTCATCAACTC
A
CATGCTGACGTCAATGCCGTGGATGACCTAGGCAAGTCGGCTTTGCATTGGGCGGCCGCGGTGAACAAT
GTG
GATGCTGCTGTTGTGCTCCTGAAGAACGGAGCCAACAAGGACATGCAGAACAACAAGGAGGAGACTC
CC
CTGTTCCTGGCCGCCCGTGAGGGCAGCTATGAGACTGCCAAAGTGTTGCTGGACCACTTTGCCAACCG
G
GACATCACGGATCACATGGACCGATTGCCGCGGGACATCGCACAGGAGCGTATGCACCACGATATCGTG
CGG
CTTTTGGATGAGTACAACCTGGTGCGCAGCCCACAGCTGCATGGCACTGCCCTGGGTGGCACACCCA
CT
CTGTCTCCCACACTCTGCTCGCCCAATGGCTACCTGGGCAATCTCAAGTCTGCCACACAGGGCAAGAA
G
GCCCGCAAGCCCAGCACCAAAGGGCTGGCTTGTGGTAGCAAGGAAGCTAAGGACCTCAAGGCACGGAGG
AAG
AAGTCCCAGGATGGCAAGGGCTGCCTGTTGGACAGCTCGAGCATGCTGTCGCCTGTGGACTCCCTCG
AG
TCACCCCATGGCTACTTGTCAGATGTGGCCTCGCCACCCCTCCTCCCCTCCCCATTCCAGCAGTCTCC
A
TCCATGCCTCTCAGCCACCTGCCTGGTATGCCTGACACTCACCTGGGCATCAGCCACTTGAATGTGGCA
GCC
AAGCCTGAGATGGCAGCACTGGCTGGAGGTAGCCGGTTGGCCTTTGAGCCACCCCCGCCACGCCTCT
CC
CACCTGCCTGTAGCCTCCAGTGCCAGCACAGTGCTGAGTACCAATGGCACGGGGGCTATGAATTTCAC
C
GTGGGTGCACCGGCAAGCTTGAATGGCCAGTGTGAGTGGCTTCCCCGGCTCCAGAATGGCATGGTGCCC
AGC
CAGTACAACCCACTACGGCCGGGTGTGACGCCGGGCACACTGAGCACACAGGCAGCTGGCCTCCAGC
AT
AGCATGATGGGGCCACTACACAGCAGCCTCTCCACCAATACCTTGTCCCCGATTATTTACCAGGGCCT
G
CCCAACACACGGCTGGCAACACAGCCTCACCTGGTGCAGACCCAGCAGGTGCAGCCACAGAACTTACAG
CTC
CAGCCTCAGAACCTGCAGCCACCATCACAGCCACACCTCAGTGTGAGCTCGGCAGCCAATGGGCACC
TG
GGCCGGAGCTTCTTGAGTGGGGAGCCCAGTCAGGCAGATGTACAACCGCTGGGCCCCAGCAGTCTGCC
T
GTGCACACCATTCTGCCCCAGGAAAGCCAGGCCCTGCCCACATCACTGCCATCCTCCATGGTCCCACCC
ATG
ACCACTACCCAGTTCCTGACCCCTCCTTCCCAGCACAGTTACTCCTCCTCCCCTGTGGACAACACCC
CC
AGCCACCAGCTGCAGGTGCCAGAGCACCCCTTCCTCACCCCATCCCCTGAGTCCCCTGACCAGTGGTC
C
AGCTCCTCCCCGCATTCCAACATCTCTGATTGGTCCGAGGGCATCTCCAGCCCGCCCACCACCATGCCG
TCC
CAGATCACCCACATTCCAGAGGCATTTAAATAA


Translation (2531 aa):
MPRLLTPLLCLTLLPALAARGLRCSQPSGTCLNGGRCEVANGTEACVCSGAFVGQRCQDSNPCLSTPCKN
A
GTCHVVDHGGTVDYACSCPLGFSGPLCLTPLDNACLANPCRNGGTCDLLTLTEYKCRCPPGWS
GKSCQQ
A
DPCASNPCANGGQCLPFESSYICRCPPGFHGPTCRQDVNECSQNPGLCRHGGTCHNEIGSYRCACRATH
T
GPHCELPYVPCSPSPCQNGGTCRPTGDTTHECACLP
GFAGQNCEENVDDCPGNNCKNGGACVDGVNTYN
C
RCPPEWT
GQYCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFQGATC
H
DRVASFYCECPHGRT
GLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECALGA
N
PCEHAGKCLNTLGSFECQCLQGYTGPRCEIDVNECISNPCQNDATCLDQIGEFQCICMP
GYEGVYCEIN
T
DECASSPCLHNGHCMDKINEFQCQCPK
GFNGHLCQYDVDECASTPCKNGAKCLDGPNTYTCVCTEGYTG
T
HCEVDIDECDPDPCHYGSCKDGVATFTCLCQPGYTGHHCETNINECHSQPCRHGGTCQDRDNSYLCLCL
K
GTT
GPNCEINLDDCASNPCDSGTCLDKIDGYECACEPGYTGSMCNVNIDECAGSPCHNGGTCEDGIAGF
T
CRCPEGYHDPTCLSEVNECNSNPCIHGACRDGLN
GYKCDCAPGWSGTNCDINNNECESNPCVNGGTCKD
M
TSGYVCTCREGFS
GPNCQTNINECASNPCLNQGTCIDDVAGYKCNCPLPYTGATCEVVLAPCATSPCKN
S
GVCKESEDYESFSCVCPTGWQ
GQTCEVDINECVKSPCRHGASCQNTNGSYRCLCQAGYTGRNCESDIDD
C
RP
NPCHNGGSCTDGINTAFCDCLPGFQGAFCEEDINECASNPCQNGANCTDCVDSYTCTCPVGFNGIHC
E
NNTPDCTE
SSCFNGGTCVDGINSFTCLCPPGFTGSYCQYDVNECDSRPCLHGGTCQDSYGTYKCTCPQG
Y
TGLNCQ
NLVRWCDSAPCKNGGRCWQTNTQYHCECRSGWTGVNCDVLSVSCEVAAQKRGIDVTLLCQHGG
L
CVDEGDKHYCHCQAGYTGSYCEDEVDECSPNPCQNGATCTDYLGGFSCK
CVAGYHGSNCSEEINECLSQ
P
CQNGGTCIDLTNSYKCSCPRGTQ
GVHCEINVDDCHPPLDPASRSPKCFNNGTCVDQVGGYTCTCPPGFV
G
ERCEGDVNECLSNPCDPRGTQNCVQRVNDFHCECRAGHT
GRRCESVINGCRGKPCKNGGVCAVASNTAR
G
FICRCPA
GFEGATCENDARTCGSLRCLNGGTCISGPRSPTCLCLGSFTGPECQFPASSPCVGSNPCYNQ
G
TCEPTSENPFYRCLCPAKFNGLLCHILDYSFTGGAGRDIPPPQIEEACELPECQVDAGNKVCNLQCNNH
A
CGWDGGDCSLNFNDPWKNCTQSLQCWKYFSDGHCDSQCNSAGCLFDGFDCQLTEGQC
NPLYDQYCKDHF
S
DGHCDQGCNSAECEWDGLDCAEHVPERLAAGTLVLVVLLPPDQLRNNSFHFLRELSHVLHTNVVFKRDA
Q
GQQMIFPYYGHEEELRKHPIKRSTVGWATSSLLPGTSGGRQRRELDPMDIR
GSIVYLEIDNRQCVQSSS
Q
CFQSATDVAAFLGALASLGSLNIPYKIEAVK
SEPVEPPLPSQLHLMYVAAAAFVLLFFVGCGVLLSRKR
R
RQHGQLWFPEGFKVSEASKKKRREPLGEDSVGL
KPLKNASDGALMDDNQNEWGDEDLETKKFRFEEPVV
L
PDLSDQTDHRQWTQQHLDAADLRMSAMAPTPPQGEVDADCMDVNVRGP
DGFTPLMIASCSGGGLETGNS
E
EEEDAPAVISDFIYQGASLHNQTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVS
A
DAQGVFQ
ILLRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNN
V
DAAVVLLKNGANKDMQNNK
EETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDIV
R
LLDEYNLVRSPQLHGTALGGTPTLSPTLCSPNGYLGNLKSATQGKKARKPSTKGLACGSKEAKDLKARR
K
KSQDGKGCLLDSSSMLSPVDSLESPHGYLSDVASPPLLPSPFQQSPSMPLSHLPGMPDTHLGISHLNVA
A
KPEMAALAGGSRLAFEPPPPRLSHLPVASSASTVLSTNGTGAMNFTVGAPASLNGQCEWLPRLQNGMVP
S
QYNPLRPGVTPGTLSTQAAGLQHSMMGPLHSSLSTNTLSPIIYQGLPNTRLATQPHLVQTQQVQPQNLQ
L
QPQNLQPPSQPHLSVSSAANGHLGRSFLSGEPSQADVQPLGPSSLPVHTILPQESQALPTSLPSSMVPP
M
TTTQFLTPPSQHSYSSSPVDNTPSHQLQVPEHPFLTPSPESPDQWSSSSPHSNISDWSEGISSPPTTMP
S
QITHIPEAFK




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser