NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS28267.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
28267.1 Public Mus musculus 16 Htr1f 21 106 86 CCDS HistoryNCBI Gene:15557Re-query CCDS DB by CCDS ID:28267.1Re-query CCDS DB by GeneID:15557See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 28267.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000063076 ENSMUSP00000063136 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000063076Link to Ensembl Protein Viewer:ENSMUSP00000063136Re-query CCDS DB by Nucleotide ID:ENSMUST00000063076Re-query CCDS DB by Protein ID:ENSMUSP00000063136
Original member Current member NCBI NM_008310.3 NP_032336.1 Accepted alive Link to Nucleotide Sequence:NM_008310.3Link to Protein Sequence:NP_032336.1Re-query CCDS DB by Nucleotide ID:NM_008310Re-query CCDS DB by Protein ID:NP_032336Link to BLink:NP_032336.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_032336.1 366 Q02284 366 100% 0 0

Chromosomal Locations for CCDS 28267.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 16 (NC_000082.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 16Link to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 64925827 64926927 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1101 nt):
ATGGATTTTTTAAACGCATCAGACCAAAACTTGACCTCTGAGGAACTGTTAAACCGAATGCCATCCAAAA
TT
CTGGTATCCCTCACTCTGTCTGGGCTGGCATTGATGACAACCACCATCAACTCCCTCGTGATCGCTGC
G
ATCATTGTGACTCGGAAGCTGCACCACCCAGCCAACTATTTAATTTGTTCCTTGGCAGTTACAGATTTT
CTT
GTAGCTGTCCTGGTGATGCCCTTCAGTATTGTGTACATTGTGAGAGAGAGCTGGATTATGGGACAAG
TA
CTCTGTGACATTTGGCTGAGTGTCGACATCATCTGTTGTACGTGTTCCATCTTGCATCTGTCGGCTAT
A
GCCTTGGATAGGTACCGCGCCATCACAGATGCAGTTGAATACGCCAGGAAGAGGACTCCCAGGCATGCC
GGC
ATCATGATCACGATCGTGTGGGTTATATCTGTGTTCATCTCTATGCCTCCTCTCTTCTGGAGGCACC
AA
GGAACTAGCCGTGATGATGAGTGTGTCATCAAACATGACCACATTGTTTCCACAATTTACTCCACGTT
T
GGAGCTTTCTACATCCCGCTTGTATTGATATTGATCCTCTACTACAAAATATACAGAGCAGCAAGGACA
CTG
TACCACAAGAGACAAGCGAGTCGGATGATAAAGGAGGAGCTGAACGGTCAAGTCTTCTTGGAGAGCG
GT
GAGAAGAGCATTAAACTGGTCTCCACATCCTACATGTTAGAAAAATCCTTGTCCGATCCATCAACGGA
C
TTTGATAGAATTCACAGCACCGTGAAAAGTCCCAGATCGGAACTGAAGCATGAGAAATCTTGGAGAAGA
CAG
AAAATCTCAGGCACCAGAGAACGCAAAGCAGCCACTACCCTGGGATTGATCTTGGGTGCATTTGTAA
TA
TGTTGGCTGCCCTTTTTTGTAAAAGAATTGGTTGTTAATGTCTGTGAAAAATGTAAAATTTCTGAAGA
A
ATGTCAAACTTTTTGGCATGGCTTGGTTACCTGAATTCCCTTATAAATCCACTGATTTATACCATCTTT
AAT
GAAGACTTCAAGAAAGCTTTCCAAAAACTTGTACGATGCCGATATTAG


Translation (366 aa):
MDFLNASDQNLTSEELLNRMPSKILVSLTLSGLALMTTTINSLVIAAIIVTRKLHHPANYLICSLAVTDF
L
VAVLVMPFSIVYIVRESWIMGQVLCDIWLSVDIICCTCSILHLSAIALDRYRAITDAVEYARKRTPRHA
G
IMITIVWVISVFISMPPLFWRHQGTSRDDECVIKHDHIVSTIYSTFGAFYIPLVLILILYYKIYRAART
L
YHKRQASRMIKEELNGQVFLESGEKSIKLVSTSYMLEKSLSDPSTDFDRIHSTVKSPRSELKHEKSWRR
Q
KISGTRERKAATTLGLILGAFVICWLPFFVKELVVNVCEKCKISEEMSNFLAWLGYLNSLINPLIYTIF
N
EDFKKAFQKLVRCRY




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser