NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS27943.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27943.1 Public Mus musculus 16 Grin2a 21 106 86 CCDS HistoryNCBI Gene:14811Re-query CCDS DB by CCDS ID:27943.1Re-query CCDS DB by GeneID:14811See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 27943.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000032331 ENSMUSP00000032331 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000032331Link to Ensembl Protein Viewer:ENSMUSP00000032331Re-query CCDS DB by Nucleotide ID:ENSMUST00000032331Re-query CCDS DB by Protein ID:ENSMUSP00000032331
Original member Current member EBI,WTSI ENSMUST00000115835 ENSMUSP00000111501 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000115835Link to Ensembl Protein Viewer:ENSMUSP00000111501Re-query CCDS DB by Nucleotide ID:ENSMUST00000115835Re-query CCDS DB by Protein ID:ENSMUSP00000111501
Original member Current member EBI,WTSI ENSMUST00000199708 ENSMUSP00000142900 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000199708Link to Ensembl Protein Viewer:ENSMUSP00000142900Re-query CCDS DB by Nucleotide ID:ENSMUST00000199708Re-query CCDS DB by Protein ID:ENSMUSP00000142900
Original member Current member EBI,WTSI OTTMUST00000038999 OTTMUSP00000017426 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000038999Link to Vega Protein Viewer:OTTMUSP00000017426Re-query CCDS DB by Nucleotide ID:OTTMUST00000038999Re-query CCDS DB by Protein ID:OTTMUSP00000017426
Original member Current member EBI,WTSI OTTMUST00000136331 OTTMUSP00000071985 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000136331Link to Vega Protein Viewer:OTTMUSP00000071985Re-query CCDS DB by Nucleotide ID:OTTMUST00000136331Re-query CCDS DB by Protein ID:OTTMUSP00000071985
Original member Current member NCBI NM_008170.2 NP_032196.2 Accepted alive Link to Nucleotide Sequence:NM_008170.2Link to Protein Sequence:NP_032196.2Re-query CCDS DB by Nucleotide ID:NM_008170Re-query CCDS DB by Protein ID:NP_032196Link to BLink:NP_032196.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_032196.2 1464 P35436 1464 100% 0 0

Chromosomal Locations for CCDS 27943.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 16 (NC_000082.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 16Link to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 9577827 9579626 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 9585026 9585264 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 9612570 9612757 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 9644099 9644259 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 9653396 9653625 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 9657674 9657799 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 9663181 9663334 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 9663439 9663607 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 9669705 9669910 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 9707604 9707718 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 9761391 9761983 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 9992120 9992533 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (4395 nt):
ATGGGCAGACTGGGCTACTGGACCTTGCTGGTATTGCCGGCCCTTCTGGTCTGGCACGGTCCGGCGCAGA
AC
GCGGCGGCGGAGAAGGGTACTCCAGCGCTGAACATTGCGGTGCTGCTGGGTCACAGCCACGACGTGAC
A
GAACGCGAACTTCGAAATCTGTGGGGCCCGGAGCAGGCAACCGGCTTGCCCCTGGATGTGAACGTGGTG
GCG
TTATTGATGAACCGCACTGACCCTAAGAGCCTCATCACGCATGTGTGCGACCTCATGTCCGGGGCGC
GC
ATCCATGGCTTGGTGTTTGGAGATGATACGGACCAAGAGGCTGTGGCTCAGATGCTGGATTTTATCTC
C
TCACAGACTTTCATCCCCATCTTGGGCATTCATGGGGGTGCATCTATGATCATGGCTGACAAGGATCCG
ACA
TCCACGTTCTTCCAGTTTGGAGCTTCCATCCAGCAGCAAGCCACGGTCATGCTGAAGATCATGCAGG
AC
TATGACTGGCATGTCTTCTCCTTGGTCACCACCATCTTCCCTGGCTACAGAGACTTCATCAGCTTCAT
C
AAGACAACAGTGGACAACAGCTTTGTGGGCTGGGATATGCAGAACGTGATCACACTGGACACCTCTTTT
GAG
GACGCCAAGACACAGGTCCAGCTGAAGAAGATCCACTCCTCTGTCATCCTGCTCTACTGCTCCAAGG
AT
GAGGCTGTCCTCATCCTGAGCGAGGCTCGCTCTCTTGGCCTCACCGGCTACGATTTCTTCTGGATTGT
C
CCCAGTTTGGTCTCCGGGAACACAGAGCTCATCCCCAAAGAGTTTCCATCGGGTCTCATTTCAGTCTCT
TAC
GACGACTGGGACTACAGTCTGGAGGCAAGAGTGAGAGACGGTCTTGGGATCTTAACCACTGCCGCAT
CT
TCCATGTTGGAGAAATTCTCCTACATTCCCGAGGCCAAGGCCAGCTGCTACGGGCAGACAGAGAAGCC
G
GAGACCCCGCTACACACTCTGCACCAATTTATGGTCAATGTGACTTGGGATGGCAAGGACTTGTCCTTC
ACT
GAGGAAGGCTATCAGGTGCACCCCAGGCTTGTGGTGATCGTGCTGAATAAGGACCGGGAATGGGAAA
AG
GTGGGCAAGTGGGAGAATCAGACTCTGAGCCTGCGGCATGCTGTGTGGCCAAGGTATAAGTCCTTTTC
T
GACTGTGAGCCAGATGACAACCACCTCAGCATTGTCACCTTGGAGGAAGCCCCCTTCGTCATCGTAGAA
GAC
ATAGACCCACTGACTGAGACCTGCGTCAGGAACACGGTACCCTGTCGGAAGTTTGTCAAGATCAACA
AT
TCAACCAACGAAGGGATGAATGTGAAGAAGTGCTGCAAGGGGTTCTGCATCGACATCCTTAAGAAACT
G
TCCAGAACTGTAAAGTTCACCTATGACCTCTACCTGGTGACCAATGGGAAGCATGGGAAAAAGGTTAAC
AAT
GTGTGGAATGGAATGATAGGCGAAGTGGTCTATCAACGAGCAGTTATGGCCGTGGGCTCCCTCACCA
TC
AATGAGGAGCGTTCAGAAGTGGTGGACTTCTCCGTGCCCTTTGTGGAGACAGGAATCAGTGTCATGGT
C
TCCAGGAGTAATGGCACTGTTTCCCCTTCTGCTTTCCTTGAACCCTTCAGCGCCTCTGTCTGGGTGATG
ATG
TTCGTGATGCTGCTCATTGTCTCTGCCATTGCTGTCTTCGTTTTTGAATACTTCAGTCCTGTTGGAT
AC
AACAGAAACTTAGCCAAAGGGAAAGCTCCCCATGGGCCTTCTTTTACCATTGGAAAAGCTATATGGCT
C
CTCTGGGGCCTGGTCTTCAACAATTCTGTGCCCGTCCAGAATCCTAAAGGCACAACCAGCAAGATAATG
GTA
TCAGTGTGGGCCTTCTTTGCCGTCATCTTCCTTGCAAGTTACACAGCCAACCTGGCTGCCTTCATGA
TC
CAGGAGGAGTTTGTGGACCAAGTGACTGGCCTCAGTGACAAGAAGTTCCAGAGACCTCATGACTATTC
T
CCGCCTTTCCGATTTGGGACAGTACCCAATGGAAGTACAGAAAGGAATATTCGTAACAACTACCCCTAT
ATG
CACCAGTACATGACCAAATTCAACCAGAGGGGCGTAGAGGATGCCTTGGTCAGCTTGAAAACTGGGA
AG
TTGGACGCTTTCATCTATGACGCAGCTGTCTTGAACTACAAGGCCGGGAGGGATGAAGGCTGTAAACT
G
GTGACCATTGGGAGCGGGTACATCTTTGCCACCACAGGCTATGGAATTGCTCTGCAGAAGGGCTCACCC
TGG
AAGAGGCAGATTGACCTCGCTCTGCTCCAGTTTGTTGGTGACGGTGAGATGGAAGAGCTGGAGACAC
TG
TGGCTTACGGGCATCTGCCACAACGAGAAGAATGAGGTGATGAGCAGCCAGCTGGACATCGACAACAT
G
GCAGGAGTTTTCTACATGCTGGCTGCAGCTATGGCCCTCAGCCTCATCACCTTCATCTGGGAGCACCTC
TTC
TACTGGAAGCTGCGCTTCTGCTTCACAGGCGTGTGTTCTGACCGGCCCGGGCTGCTCTTCTCCATCA
GC
AGGGGCATCTACAGTTGCATCCATGGAGTGCACATTGAAGAAAAGAAGAAGTCTCCAGACTTCAATCT
G
ACTGGGTCACAGAGCAACATGCTAAAGCTTCTCCGCTCAGCTAAAAACATCTCCAACATGTCCAACATG
AAC
TCCTCGCGAATGGACTCACCCAAAAGAGCTGCTGACTTCATCCAAAGAGGCTCACTTATTGTGGACA
TG
GTTTCAGACAAGGGAAATTTGATATACTCAGATAACAGGTCCTTTCAAGGGAAGGACAGTATATTTGG
A
GAAAACATGAATGAACTGCAAACATTTGTGGCCAACAGGCACAAGGATAGTCTCAGTAACTATGTGTTT
CAG
GGACAGCATCCTCTCACTCTCAATGAGTCCAACCCCAACACAGTGGAGGTGGCTGTCAGCACTGAAT
CC
AAAGGGAACTCCCGACCCCGGCAGCTTTGGAAGAAATCCATGGAGTCTCTACGCCAGGATTCTCTAAA
C
CAGAACCCAGTCTCCCAGAGGGATGAGAAGACTGCAGAGAATAGGACCCACTCCCTAAAGAGTCCTAGG
TAT
CTTCCAGAAGAGGTAGCCCATTCTGACATTTCTGAAACCTCAAGCCGGGCCACATGCCACAGGGAGC
CA
GATAATAATAAGAACCACAAGACCAAGGATAACTTCAAAAGGTCAATGGCCTCTAAATACCCCAAGGA
C
TGTAGTGAGGTTGAACGTACCTACGTGAAAACCAAAGCAAGTTCTCCCAGGGATAAGATCTACACCATC
GAT
GGTGAGAAGGAGCCCAGCTTCCACTTAGATCCTCCACAGTTCATTGAAAACATAGTCTTGCCTGAGA
AT
GTGGACTTCCCAGATACCTACCAAGATCACAATGAGAATTTCCGCAAGGGGGACTCCACACTGCCCAT
G
AACAGGAACCCACTACACAATGAAGATGGGCTTCCCAACAATGACCAGTATAAACTCTATGCCAAGCAC
TTT
ACCTTGAAAGACAAGGGTTCCCCACATAGTGAGGGCAGTGATCGATATCGGCAGAACTCCACGCATT
GC
AGAAGCTGCCTCTCAAACCTGCCCACCTACTCAGGCCACTTTACCATGAGATCTCCTTTCAAGTGTGA
T
GCCTGTCTGCGGATGGGGAACCTCTATGACATTGATGAAGACCAGATGCTTCAGGAGACAGGCAACCCA
GCT
ACTCGTGAGGAGGCCTACCAGCAGGACTGGTCACAGAACAACGCCCTCCAGTTCCAGAAGAACAAGC
TA
AAGATTAATCGACAGCACTCCTATGATAACATTCTCGACAAACCCAGGGAGATAGACCTTAGCAGGCC
C
TCTCGTAGCATAAGCCTCAAGGACAGGGAAAGGCTACTGGAGGGCAACTTATACGGGAGCCTGTTCAGT
GTC
CCCTCAAGCAAACTCTTGGGGAACAAAAGCTCCCTTTTCCCCCAAGGTCTGGAGGACAGCAAGAGGA
GC
AAATCTCTCTTGCCAGACCATACCTCTGATAATCCTTTCCTCCACACGTACGGGGATGACCAACGCTT
A
GTTATTGGGAGATGTCCCTCGGACCCTTACAAACACTCATTGCCATCACAGGCAGTAAATGACAGCTAT
CTT
CGGTCATCCTTGAGGTCAACAGCATCATATTGCTCCAGGGACAGTCGGGGCCACAGTGATGTGTATA
TT
TCAGAGCATGTTATGCCTTATGCTGCAAATAAGAATAACATGTACTCTACCCCCAGGGTTTTAAATTC
C
TGCAGCAATAGACGTGTGTACAAGAAAATGCCTAGTATTGAATCTGATGTCTAA


Translation (1464 aa):
MGRLGYWTLLVLPALLVWHGPAQNAAAEKGTPALNIAVLLGHSHDVTERELRNLWGPEQATGLPLDVNVV
A
LLMNRTDPKSLITHVCDLMSGARIHGLVFGDDTDQEAVAQMLDFISSQTFIPILGIHGGASMIMADK
DP
T
STFFQFGASIQQQATVMLKIMQDYDWHVFSLVTTIFPGYRDFISFIKTTVDNSFVGWDMQNVITLDTSF
E
DAKTQVQLKKIHSSVILLYCSKDEAVLILSEARSLGLTGYDFFWIVPSLVSGNTELIPKEFPSGLISVS
Y
DDWDYSLEARVRDGLGILTTAASSMLEKFSYIPEAKASCYGQTEKPETPLHTLH
QFMVNVTWDGKDLSF
T
EEGYQVHPRLVVIVLNKDREWEK
VGKWENQTLSLRHAVWPRYKSFSDCEPDDNHLSIVTLEEAPFVIVE
D
IDPLTETCVRNTVPCRKFVKI
NNSTNEGMNVKKCCKGFCIDILKKLSRTVKFTYDLYLVTNGKHGKKVN
N
VWNGMIGE
VVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASVWVM
M
FVMLLIVSAIAVFVFEYFSPVGYNRNLAKGK
APHGPSFTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIM
V
SVWAFFAVIFLASYTANLAAFMIQEEFVDQVTGLSDKK
FQRPHDYSPPFRFGTVPNGSTERNIRNNYPY
M
HQYMTKFNQRGVEDALVSLKT
GKLDAFIYDAAVLNYKAGRDEGCKLVTIGSGYIFATTGYGIALQKGSP
W
KRQIDLALLQFVGD
GEMEELETLWLTGICHNEKNEVMSSQLDIDNMAGVFYMLAAAMALSLITFIWEHL
F
YWKLRFCFTGVCSDRPGLLFSISR
GIYSCIHGVHIEEKKKSPDFNLTGSQSNMLKLLRSAKNISNMSNM
N
SSRMDSPKRAADFIQRGSLIVDMVSDKGNLIYSDNRSFQGKDSIFGENMNELQTFVANRHKDSLSNYVF
Q
GQHPLTLNESNPNTVEVAVSTESKGNSRPRQLWKKSMESLRQDSLNQNPVSQRDEKTAENRTHSLKSPR
Y
LPEEVAHSDISETSSRATCHREPDNNKNHKTKDNFKRSMASKYPKDCSEVERTYVKTKASSPRDKIYTI
D
GEKEPSFHLDPPQFIENIVLPENVDFPDTYQDHNENFRKGDSTLPMNRNPLHNEDGLPNNDQYKLYAKH
F
TLKDKGSPHSEGSDRYRQNSTHCRSCLSNLPTYSGHFTMRSPFKCDACLRMGNLYDIDEDQMLQETGNP
A
TREEAYQQDWSQNNALQFQKNKLKINRQHSYDNILDKPREIDLSRPSRSISLKDRERLLEGNLYGSLFS
V
PSSKLLGNKSSLFPQGLEDSKRSKSLLPDHTSDNPFLHTYGDDQRLVIGRCPSDPYKHSLPSQAVNDSY
L
RSSLRSTASYCSRDSRGHSDVYISEHVMPYAANKNNMYSTPRVLNSCSNRRVYKKMPSIESDV




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser