NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS23104.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
23104.1 Public Mus musculus 9 Dpagt1 21 106 86 CCDS HistoryNCBI Gene:13478Re-query CCDS DB by CCDS ID:23104.1Re-query CCDS DB by GeneID:13478See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 23104.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000054708 ENSMUSP00000056282 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000054708Link to Ensembl Protein Viewer:ENSMUSP00000056282Re-query CCDS DB by Nucleotide ID:ENSMUST00000054708Re-query CCDS DB by Protein ID:ENSMUSP00000056282
Original member Current member NCBI NM_007875.2 NP_031901.2 Accepted alive Link to Nucleotide Sequence:NM_007875.2Link to Protein Sequence:NP_031901.2Re-query CCDS DB by Nucleotide ID:NM_007875Re-query CCDS DB by Protein ID:NP_031901Link to BLAST:NP_031901.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_031901.2 410 P42867 410 100% 0 0

Chromosomal Locations for CCDS 23104.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 9Link to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 44327039 44327205 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 44327552 44327672 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 44327953 44328166 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 44328991 44329137 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 44331118 44331202 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 44331904 44332092 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 44332563 44332650 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 44332816 44332971 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 44333057 44333122 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1233 nt):
ATGTGGGCCTTCCCGGAGTTGCCCCTGCCGCTGCCGCTGCTGGTGAATTTGATCGGCTCGCTGTTGGGAT
TC
GTGGCTACAGTCACCCTCATCCCTGCCTTCCGTAGCCACTTTATCGCCGCGCGCCTCTGTGGCCAGGA
C
CTCAACAAGCTCAGCCAGCAGCAGATCCCAGAGTCCCAGGGAGTGATCAGCGGTGCTGTTTTCCTTATC
ATC
CTCTTCTGCTTCATCCCTTTCCCCTTCCTGAACTGCTTCGTGGAGGAGCAGTGTAAGGCATTCCCCC
AC
CATGAATTTGTGGCCCTAATAGGTGCCCTCCTTGCCATCTGCTGCATGATCTTCCTGGGGTTTGCTGA
T
GATGTCCTCAATCTCCGCTGGCGCCACAAGCTGCTGCTGCCCACAGCTGCCTCACTACCTCTCCTCATG
GTC
TACTTCACAAACTTTGGCAATACAACCATCGTGGTGCCCAAGCCCTTCCGCTGGATTCTGGGCCTGC
AT
TTGGACTTGGGGATCCTGTACTACGTCTACATGGGGCTGCTTGCAGTGTTCTGTACCAATGCCATCAA
C
ATCCTGGCGGGCATTAATGGCCTAGAGGCCGGTCAGTCACTAGTCATCTCTGCTTCTATCATTGTCTTC
AAC
CTGGTGGAACTGGAAGGTGATTATCGAGATGATCATATCTTTTCCCTTTACTTCATGATACCATTTT
TC
TTTACCACCTTGGGACTGCTTTACCACAACTGGTACCCGTCCCGCGTGTTTGTGGGAGACACCTTCTG
T
TACTTTGCGGGCATGACTTTTGCCGTGGTGGGGATCTTGGGACACTTCAGCAAGACCATGCTGCTCTTC
TTT
ATGCCACAAGTATTCAATTTCCTCTACTCACTGCCTCAGCTCTTCCATATCATCCCCTGCCCTCGAC
AC
CGGATGCCCAGACTCAACGCAAAGACAGGCAAACTGGAAATGAGCTATTCCAAGTTCAAGACCAAGAA
C
CTCTCTTTCCTGGGCACCTTTATTTTAAAGGTAGCAGAGAACCTCCGGTTAGTGACAGTTCACCAAGGT
GAG
AGTGAGGACGGTGCCTTCACTGAGTGTAACAACATGACCCTCATCAACTTGCTACTTAAAGTCTTTG
GG
CCTATACATGAGAGAAACCTCACCCTGCTCCTGCTGCTCCTGCAGGTCCTAAGCAGCGCCGCCACCTT
C
TCCATTCGTTACCAACTCGTCCGACTCTTCTATGATGTCTGA


Translation (410 aa):
MWAFPELPLPLPLLVNLIGSLLGFVATVTLIPAFRSHFIAARLCGQDLNKLSQQQIPESQGVISGAVFLI
I
LFCFIPFPFLNCFVEEQCKAFPHHE
FVALIGALLAICCMIFLGFADDVLNLRWRHKLLLPTAASLPLLM
V
YFTNFGNTTIVVPKPFRWILGLHLDL
GILYYVYMGLLAVFCTNAINILAGINGLEAGQSLVISASIIVF
N
LVELE
GDYRDDHIFSLYFMIPFFFTTLGLLYHNWYPSRVFVGDTFCYFAGMTFAVVGILGHFSKTMLLF
F
MPQVFNFLYSLPQLFHIIPCPRHRMP
RLNAKTGKLEMSYSKFKTKNLSFLGTFILKVAENLRLVTVHQG
E
SEDGAFTECNNMTLINLLLKVFGPIHERNLTLLLLLLQ
VLSSAATFSIRYQLVRLFYDV



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser