NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS19653.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19653.1 Public Mus musculus 5 P2rx7 21 106 86 CCDS HistoryNCBI Gene:18439Re-query CCDS DB by CCDS ID:19653.1Re-query CCDS DB by GeneID:18439See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 19653.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000086247 ENSMUSP00000083425 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000086247Link to Ensembl Protein Viewer:ENSMUSP00000083425Re-query CCDS DB by Nucleotide ID:ENSMUST00000086247Re-query CCDS DB by Protein ID:ENSMUSP00000083425
Original member Current member EBI,WTSI OTTMUST00000066140 OTTMUSP00000033093 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000066140Link to Vega Protein Viewer:OTTMUSP00000033093Re-query CCDS DB by Nucleotide ID:OTTMUST00000066140Re-query CCDS DB by Protein ID:OTTMUSP00000033093
Original member Current member NCBI NM_001038887.1 NP_001033976.1 Accepted alive Link to Nucleotide Sequence:NM_001038887.1Link to Protein Sequence:NP_001033976.1Re-query CCDS DB by Nucleotide ID:NM_001038887Re-query CCDS DB by Protein ID:NP_001033976Link to BLink:NP_001033976.1

Chromosomal Locations for CCDS 19653.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 5Link to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 122644074 122644198 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 122652727 122652895 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 122654161 122654229 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 122654979 122655077 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (462 nt):
ATGCCGGCTTGCTGCAGCTGGAACGATGTCTTGCAGTATGAGACAAACAAAGTCACCCGGATCCAGAGCA
CG
AATTATGGCACCGTCAAGTGGGTCTTGCACATGATCGTCTTTTCCTACATTAGCTTTGCTTTGGTGAG
C
GATAAGCTGTACCAGCGGAAAGAGCCTGTTATCAGCTCCGTGCACACCAAGGTCAAAGGCATAGCAGAG
GTG
ACGGAGAATGTCACAGAGGGTGGGGTGACGAAGTTAGGACACAGCATCTTTGACACTGCAGACTACA
CC
TTCCCTTTGCAGGGGAACTCATTCTTTGTCATGACAAACTATGTCAAGTCAGAAGGCCAAGTGCAGAC
G
CTGTGTCCTGAGGATCTTTCCAACCTCCAGGAGAGTAACCAGACTTCCAAACCACTGCTCAGGAATCCC
AGA
GCCAAGAAGGAAGAAGGCTTAAGCCTGGAGCTGGCCTAA


Translation (153 aa):
MPACCSWNDVLQYETNKVTRIQSTNYGTVKWVLHMIVFSYISFALVSDKLYQRKEPVISSVHTKVKGIAE
V
TENVTEGGVTKLGHSIFDTADYTFPLQ
GNSFFVMTNYVKSEGQVQTLCPEDLSNLQESNQTSKPLLRNP
R
AKKEEGLSLELA




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser