NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS52612.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
52612.1 Public Mus musculus 8 Adgre5 21 106 86 CCDS HistoryNCBI Gene:26364Re-query CCDS DB by CCDS ID:52612.1Re-query CCDS DB by GeneID:26364See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 52612.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000166939 ENSMUSP00000128220 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000166939Link to Ensembl Protein Viewer:ENSMUSP00000128220Re-query CCDS DB by Nucleotide ID:ENSMUST00000166939Re-query CCDS DB by Protein ID:ENSMUSP00000128220
Original member Current member EBI,WTSI OTTMUST00000150317 OTTMUSP00000077938 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000150317Link to Vega Protein Viewer:OTTMUSP00000077938Re-query CCDS DB by Nucleotide ID:OTTMUST00000150317Re-query CCDS DB by Protein ID:OTTMUSP00000077938
Original member Current member NCBI NM_001163031.1 NP_001156503.1 Accepted alive Link to Nucleotide Sequence:NM_001163031.1Link to Protein Sequence:NP_001156503.1Re-query CCDS DB by Nucleotide ID:NM_001163031Re-query CCDS DB by Protein ID:NP_001156503Link to BLAST:NP_001156503.1

Chromosomal Locations for CCDS 52612.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 8 (NC_000074.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 83723873 83723902 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 83723979 83724077 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 83724192 83724360 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 83724438 83724529 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 83724618 83724687 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 83724769 83724998 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 83725155 83725346 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 83725865 83726029 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 83727745 83727968 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 83728095 83728211 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 83728281 83728440 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 83729057 83729134 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 83729257 83729303 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 83729382 83729525 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 83733414 83733566 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 83734009 83734125 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 83734302 83734352 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8
8 83741107 83741137 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8Link to Vega Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2169 nt):
ATGAGGGGCGTCAGATGCCCCGGCCTGCTTGTGGTGTGCATTTTACTGAGTCTCTCAGGAGCTGGAACCC
AG
AAGGCAGAGAACTGTGCCAAGTGGTGCCCTATCAACTCAAAATGTGTCAGTAACAGAAGCTGTGTCTG
C
AAGCCCGGCTTCAGCTCGGAGAAGGAATTGATCACTAACCCTGCAGAGAGCTGTGAAGACATCAACGAG
TGT
TTACTACCTGGATTTTCCTGTGGAGACTTTGCCATGTGTAAGAACTCAGAGGGGAGTTACACCTGCG
TC
TGTAACCTGGGATATAAGCTCCTTTCTGGTGCAGAATCTTTTGTTAACGAGAGTGAGAATACATGTCA
A
GATGTGGATGAGTGCAGCTCTGGGCAGCATCAATGTCACAATTCCACCGTCTGCAAAAACACCGTAGGC
TCC
TACAAGTGCCACTGCCGTCCAGGTTGGAAGCCAACTTCTGGGTCCCTCCGTGGTCCAGACACCATAT
GC
CAAGAGCCACCGTTCCCTACTTGGACACTGCTGCCCACAGCCCACAGTCAGACTCTCTTGAGATTCTC
T
GTTGAAGTCCAGAATCTGCTCCGTGACTTCAATCCAGCCACGGTCAACTACACCATCCAGAAACTCATC
GAG
GCTGTGGACAAGCTGCTGGAAGACCCCATGGAGACTGAAACCCAACAAGTAGCTGCCCAGTTGCTCT
CG
AACCTGGAACAAAGCCTTCGGACCTTGGCTCAGTTTTTACCCAAAGGCCCCTTCACCTACACGTCCCC
T
TCAAATACTGAACTGTCCCTGATGGTGAAGGAGCAAGACAACAAAGATGTTACCACAGTGCACCACGGC
CAA
ACTTGGATGGAGCTGGACTGGGCTGTGACAGCTGGAGCCAAAATCTCAGAAAATGGCTCCTCGGTGG
CA
GGCATCCTGTCCAGCCCAAACATGGAAAAGCTGCTGGGCAACACCCCGCTGAACTTGGAGCAGAGAAG
G
GCCTCCTTGGAGGACTTCTATGGAAGCCCGATTCCGAGTGTCTCACTTAAGCTTCTCTCAAACATCAAT
TCT
GTCTTCCTGACCAACACGAACACTGAAAAGCTCGCCTCGAATGTCACGTTCAAGTTCGACTTTACTT
CT
GTGGAGTCAATTGAGCCACGTCATGAGCTGATATGTGCCTTCTGGAAAGCCCACAACGGGAATGGGTA
C
TGGGACACCGACGGCTGCTCAATGAATGGCACTGGCTTCTGCCACTGCAACCACCTGACCAGCTTTGCC
ATC
CTAATGGCTCAGTACCATGTGCAGGACCCAAGGCTGGAATTGATCACCAAGGTGGGGCTGTTGTTGT
CC
CTGATCTGCCTGCTGCTGTGCATCCTGACCTTCCTGCTGGTGAAGCCCATCCAGAGCTCTCGAACCAT
G
GTGCACCTGCACCTGTGCATCTGCCTCTTCCTGGGCTCAATCATATTCCTGGTCGGCGTGGAGAATGAA
GGG
GGTGAGGTGGGCCTGCGCTGCCGCCTGGTGGCCGTGATGCTGCATTTCTGCTTCCTGGCCGCCTTCT
GC
TGGATGGCACTGGAGGGCGTGGAGCTCTACTTCCTGGTGGTGCGTGTGTTCCAGGGCCAAGGCCTGAG
T
ACATGGCAACGCTGCCTGATTGGCTACGGGGTGCCCCTCCTCATCGTGGCCATCTCAATGGCAGTTGTC
AAA
ATGGATGGCTATGGGCATGCAACATACTGCTGGCTGGACTTTAGGAAGCAGGGCTTTCTCTGGAGCT
TT
TCGGGACCCGTGGCCTTCATCATTTTCTGCAATGCTGCCATTTTCGTGATCACTGTCTGGAAGCTCAC
A
AAGAAGTTTTCTGAAATCAACCCAAACATGAAGAAGTTAAGGAAGGCGAGGGTGCTGACCATCACCTCC
ATC
GCCCAGCTCCTTGTGCTGGGCTGCACCTGGGGCTTCGGCCTGTTCCTCTTCAACCCCCATAGCACAT
GG
CTATCCTACATCTTTACCCTGCTCAACTGCCTGCAGGGCCTATTCCTCTATGTGATGCTCTGCCTGCT
C
AACAAAAAGGTGAGGGAAGAGTACTGGAAATGGGCCTGCATGGTCACTGGGAGCAAGTACACAGAGTTC
AAC
TCTTCCACAACAGGCACTGGCACCAGCCAAACACGGGCTCTCAGGTCCTCAGAATCAGGGATGTGA


Translation (722 aa):
MRGVRCPGLLVVCILLSLSGAGTQKAENCAKWCPINSKCVSNRSCVCKPGFSSEKELITNPAESCEDINE
C
LLPGFSCGDFAMCKNSEGSYTCVCNLGYKLLSGAESFVNESENTCQ
DVDECSSGQHQCHNSTVCKNTVG
S
YKCHCRPGWKPTSGSLRGPDTICQ
EPPFPTWTLLPTAHSQTLLRFSVEVQNLLRDFNPATVNYTIQKLI
E
AVDKLLEDPMETETQQVAAQLLSNLEQSLRTLAQFLPKGPFTYTSPSNT
ELSLMVKEQDNKDVTTVHHG
Q
TWMELDWAVTAGAKISEN
GSSVAGILSSPNMEKLLGNTPLNLEQRRASLEDFYGSPIPSVSLKLLSNIN
S
VFLTNTNTEKLASNVTFKFDFTS
VESIEPRHELICAFWKAHNGNGYWDTDGCSMNGTGFCHCNHLTSFA
I
LMAQYHVQ
DPRLELITKVGLLLSLICLLLCILTFLLVKPIQSSRTMVHLHLCICLFLGSIIFLVGVENE
G
GE
VGLRCRLVAVMLHFCFLAAFCWMALEGVELYFLVVRVFQGQGLSTWQRCLIGYGVPLLIVAISMAVV
K
MDGYGHAT
YCWLDFRKQGFLWSFSGPVAFIIFCNAAIFVITVWKLTKKFSEINPNMKKLRKARVLTITS
I
AQLLVLGCTWGFGLFLFNPHSTWLSYIFTLLNCLQGLFLYVMLCLLNKK
VREEYWKWACMVTGSKYTEF
N
SSTTGTGTSQTR
ALRSSESGM



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser