NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS18806.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
18806.1 Public Mus musculus 4 Htr1d 21 106 86 CCDS HistoryNCBI Gene:15552Re-query CCDS DB by CCDS ID:18806.1Re-query CCDS DB by GeneID:15552See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 18806.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000088677 ENSMUSP00000086052 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000088677Link to Ensembl Protein Viewer:ENSMUSP00000086052Re-query CCDS DB by Nucleotide ID:ENSMUST00000088677Re-query CCDS DB by Protein ID:ENSMUSP00000086052
Original member Current member EBI,WTSI ENSMUST00000121571 ENSMUSP00000112402 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000121571Link to Ensembl Protein Viewer:ENSMUSP00000112402Re-query CCDS DB by Nucleotide ID:ENSMUST00000121571Re-query CCDS DB by Protein ID:ENSMUSP00000112402
Original member Current member EBI,WTSI ENSMUST00000117699 ENSMUSP00000112840 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000117699Link to Ensembl Protein Viewer:ENSMUSP00000112840Re-query CCDS DB by Nucleotide ID:ENSMUST00000117699Re-query CCDS DB by Protein ID:ENSMUSP00000112840
Original member Current member EBI,WTSI OTTMUST00000022402 OTTMUSP00000010214 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000022402Link to Vega Protein Viewer:OTTMUSP00000010214Re-query CCDS DB by Nucleotide ID:OTTMUST00000022402Re-query CCDS DB by Protein ID:OTTMUSP00000010214
Original member Current member EBI,WTSI OTTMUST00000070934 OTTMUSP00000036224 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000070934Link to Vega Protein Viewer:OTTMUSP00000036224Re-query CCDS DB by Nucleotide ID:OTTMUST00000070934Re-query CCDS DB by Protein ID:OTTMUSP00000036224
Original member Current member EBI,WTSI OTTMUST00000022403 OTTMUSP00000036225 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000022403Link to Vega Protein Viewer:OTTMUSP00000036225Re-query CCDS DB by Nucleotide ID:OTTMUST00000022403Re-query CCDS DB by Protein ID:OTTMUSP00000036225
Original member Current member NCBI NM_001285482.1 NP_001272411.1 Accepted alive Link to Nucleotide Sequence:NM_001285482.1Link to Protein Sequence:NP_001272411.1Re-query CCDS DB by Nucleotide ID:NM_001285482Re-query CCDS DB by Protein ID:NP_001272411Link to BLAST:NP_001272411.1
Original member Current member NCBI NM_001285483.1 NP_001272412.1 Accepted alive Link to Nucleotide Sequence:NM_001285483.1Link to Protein Sequence:NP_001272412.1Re-query CCDS DB by Nucleotide ID:NM_001285483Re-query CCDS DB by Protein ID:NP_001272412Link to BLAST:NP_001272412.1
Original member Current member NCBI NM_001285484.1 NP_001272413.1 Accepted alive Link to Nucleotide Sequence:NM_001285484.1Link to Protein Sequence:NP_001272413.1Re-query CCDS DB by Nucleotide ID:NM_001285484Re-query CCDS DB by Protein ID:NP_001272413Link to BLAST:NP_001272413.1
Original member Current member NCBI NM_008309.5 NP_032335.2 Accepted alive Link to Nucleotide Sequence:NM_008309.5Link to Protein Sequence:NP_032335.2Re-query CCDS DB by Nucleotide ID:NM_008309Re-query CCDS DB by Protein ID:NP_032335Link to BLAST:NP_032335.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001272411.1 374 Q61224 374 100% 0 0
NP_001272412.1 374 Q61224 374 100% 0 0
NP_001272413.1 374 Q61224 374 100% 0 0
NP_032335.2 374 Q61224 374 100% 0 0

Chromosomal Locations for CCDS 18806.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 4Link to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 136442462 136443586 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1125 nt):
ATGTCTCCTCCAAACCAGTCCCTAGAAGGCCTTCCTCAGGAGGCCTCCAACAGATCCCTGAATGTGACAG
GG
GCTTGGGACCCAGAGGTCCTGCAGGCTCTCAGAATCTCGCTCGTGGTGGTGCTGTCCGTCATCACACT
G
GCCACTGTCCTCTCCAATGCCTTCGTCCTTACCACCATTCTACTCACCAAGAAGCTCCACACCCCAGCC
AAT
TATCTCATTGGCTCCTTGGCCACCACGGACCTCCTGGTTTCTATCTTGGTCATGCCCATCAGCATAG
CC
TACACCACCACCCGCACCTGGAACTTTGGCCAGATCCTGTGTGACATCTGGGTGTCTTCTGACATCAC
G
TGCTGCACGGCCTCCATCTTGCATCTCTGTGTCATTGCTCTGGACAGATACTGGGCCATCACCGATGCC
CTG
GAGTACAGCAAGCGTCGAACCGCAGGCCACGCAGCAGCCATGATTGCGGCCGTCTGGATCATCTCTA
TT
TGTATCTCCATCCCTCCACTCTTCTGGCGGCAGGCCACGGCTCACGAGGAGATGTCCGACTGCCTGGT
G
AACACATCTCAGATTTCTTACACCATCTACTCGACCTGTGGCGCCTTCTATATCCCATCCATCTTGCTC
ATT
ATCCTGTATGGCCGCATATACGTGGCCGCCCGGAGTCGAATCCTGAACCCACCCTCCCTCTACGGGA
AG
CGCTTCACCACGGCACAGCTTATCACAGGCTCTGCTGGCTCTTCGCTCTGCTCGCTCAACCCCAGCCT
C
CATGAGAGCCACACACACACAGTTGGCTCCCCTCTCTTTTTCAACCAGGTGAAAATCAAGCTTGCTGAT
AGC
ATCCTAGAACGCAAGAGGATCTCTGCAGCCCGAGAAAGGAAAGCCACTAAGACCCTGGGCATCATTC
TG
GGGGCCTTTATCATCTGCTGGTTGCCTTTCTTTGTAGTATCATTGGTCCTCCCCATCTGCAGGGACTC
T
TGTTGGATCCACCCGGCCCTCTTTGACTTCTTCACGTGGCTAGGTTATTTAAACTCTCTCATTAACCCC
GTC
ATCTACACTGTGTTCAACGAAGACTTTCGACAAGCGTTTCAGAAAGTCGTCCATTTCCGGAAGATCT
CA
TAG


Translation (374 aa):
MSPPNQSLEGLPQEASNRSLNVTGAWDPEVLQALRISLVVVLSVITLATVLSNAFVLTTILLTKKLHTPA
N
YLIGSLATTDLLVSILVMPISIAYTTTRTWNFGQILCDIWVSSDITCCTASILHLCVIALDRYWAITDA
L
EYSKRRTAGHAAAMIAAVWIISICISIPPLFWRQATAHEEMSDCLVNTSQISYTIYSTCGAFYIPSILL
I
ILYGRIYVAARSRILNPPSLYGKRFTTAQLITGSAGSSLCSLNPSLHESHTHTVGSPLFFNQVKIKLAD
S
ILERKRISAARERKATKTLGIILGAFIICWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSLINP
V
IYTVFNEDFRQAFQKVVHFRKIS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser