NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS51013.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
51013.1 Public Mus musculus 3 Notch2 21 106 86 CCDS HistoryNCBI Gene:18129Re-query CCDS DB by CCDS ID:51013.1Re-query CCDS DB by GeneID:18129See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 51013.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000079812 ENSMUSP00000078741 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000079812Link to Ensembl Protein Viewer:ENSMUSP00000078741Re-query CCDS DB by Nucleotide ID:ENSMUST00000079812Re-query CCDS DB by Protein ID:ENSMUSP00000078741
Original member Current member EBI,WTSI OTTMUST00000132998 OTTMUSP00000070816 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000132998Link to Vega Protein Viewer:OTTMUSP00000070816Re-query CCDS DB by Nucleotide ID:OTTMUST00000132998Re-query CCDS DB by Protein ID:OTTMUSP00000070816
Original member Current member NCBI NM_010928.2 NP_035058.2 Accepted alive Link to Nucleotide Sequence:NM_010928.2Link to Protein Sequence:NP_035058.2Re-query CCDS DB by Nucleotide ID:NM_010928Re-query CCDS DB by Protein ID:NP_035058Link to BLink:NP_035058.2

Chromosomal Locations for CCDS 51013.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 3 (NC_000069.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 3Link to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 98013699 98013771 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 98047728 98047809 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 98070860 98071119 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 98072587 98072922 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 98081917 98082039 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 98098096 98098329 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 98099424 98099579 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 98100200 98100388 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 98101521 98101634 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 98102326 98102439 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 98104349 98104582 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 98107047 98107157 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 98111550 98111742 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 98113010 98113155 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 98115232 98115345 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 98116701 98116820 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 98117193 98117345 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 98120727 98120955 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 98121904 98122105 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 98123745 98123898 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 98124149 98124333 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 98126112 98126244 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 98131198 98131434 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 98134559 98134671 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 98135326 98135831 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 98137275 98137628 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 98138386 98138528 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 98138642 98138852 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 98139586 98139682 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 98141464 98141629 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 98142893 98143194 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 98144362 98144509 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 98145122 98145219 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 98146053 98147444 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (7422 nt):
ATGCCCGCTCTGCGTCCCGCCGCGCTGCGGGCGCTGCTGTGGCTCTGGCTGTGCGGCGCGGGCCCCGCGC
AC
GCTTTGCAGTGTCGAGGTGGTCAAGAGCCCTGTGTAAATGAAGGGACCTGTGTTACCTACCACAACGG
C
ACAGGCTTCTGCCGATGTCCAGAGGGCTTCTTGGGAGAATATTGCCAACATCGAGACCCCTGTGAGAAA
AAC
CGCTGTCAGAATGGTGGTACTTGTGTGCCGCAGGGCATGTTGGGGAAAGCTACCTGCCGATGTGCTC
CA
GGATTCACAGGAGAGGACTGCCAATACTCCACCTCTCACCCCTGCTTTGTGTCCCGCCCTTGTCAGAA
T
GGGGGTACCTGTCACATGCTCAGCCGGGACACCTACGAGTGCACCTGCCAAGTCGGCTTCACAGGGAAG
CAG
TGTCAGTGGACAGATGCCTGTCTATCTCATCCCTGCGAAAATGGAAGCACCTGTACATCTGTGGCCA
GC
CAGTTCTCCTGCAAATGCCCTGCAGGCCTCACAGGGCAGAAGTGTGAAGCTGATATCAATGAGTGTGA
C
ATTCCAGGACGCTGCCAACATGGTGGCACCTGCCTCAACCTTCCTGGTTCCTACAGATGCCAATGTCCT
CAG
GGCTTCACAGGCCAGCACTGTGACAGCCCTTATGTGCCCTGTGCACCCTCGCCCTGCGTCAACGGAG
GC
ACCTGTCGTCAGACTGGCGACTTCACTTTCGAATGCAACTGCCTGCCAGGTTTTGAAGGGAGCACCTG
T
GAGCGGAATATCGACGACTGCCCCAACCACAAGTGTCAGAATGGAGGAGTTTGTGTGGATGGTGTCAAT
ACC
TACAATTGCCGCTGTCCCCCTCAGTGGACTGGGCAGTTCTGCACAGAAGATGTGGACGAGTGTCTGT
TG
CAGCCCAACGCTTGTCAGAATGGAGGCACCTGCACCAACCGAAACGGAGGCTATGGCTGCGTGTGTGT
G
AACGGCTGGAGCGGAGATGACTGCAGCGAGAATATCGATGACTGTGCCTATGCTTCCTGCACGCCAGGG
TCC
ACCTGCATTGACCGCGTGGCCTCCTTCTCCTGCCTGTGTCCGGAGGGAAAGGCGGGTCTCCTGTGCC
AT
CTGGATGATGCCTGTATCAGCAACCCTTGTCACAAGGGGGCGCTGTGTGACACCAACCCCCTGAACGG
G
CAGTACATTTGCACCTGCCCACAGGGCTACAAGGGCGCTGACTGCACAGAAGACGTGGATGAGTGTGCT
ATG
GCCAACAGTAACCCTTGTGAGCATGCAGGAAAGTGTGTGAATACAGATGGCGCCTTCCACTGTGAGT
GT
CTGAAGGGCTACGCAGGGCCTCGCTGTGAGATGGACATCAACGAGTGTCATTCAGACCCCTGCCAGAA
C
GACGCCACCTGCCTGGATAAGATCGGAGGCTTCACCTGTCTGTGCATGCCAGGTTTCAAAGGTGTGCAT
TGT
GAGCTGGAGGTAAATGAATGCCAGAGCAACCCGTGTGTGAACAACGGGCAGTGTGTGGACAAAGTCA
AC
CGCTTCCAGTGTCTGTGTCCCCCTGGCTTCACAGGACCAGTGTGCCAGATCGACATTGATGACTGCTC
C
AGTACTCCCTGCCTGAATGGGGCCAAGTGCATCGATCACCCGAATGGCTATGAATGCCAGTGTGCCACA
G
GT
TTCACTGGCATATTGTGTGATGAGAACATCGACAACTGTGACCCAGATCCTTGCCACCATGGCCAGT
GC
CAGGATGGGATCGACTCCTACACCTGCATCTGCAACCCTGGGTACATGGGAGCCATCTGTAGTGACCA
G
ATTGATGAATGCTACAGCAGCCCTTGCTTGAACGATGGGCGCTGCATTGACCTGGTGAATGGTTACCAG
TGC
AACTGCCAACCAGGCACATCAGGCCTTAATTGTGAAATTAATTTTGATGACTGTGCCAGCAACCCTT
GT
ATGCACGGAGTCTGTGTGGACGGCATCAATCGCTACAGCTGTGTGTGCTCTCCGGGATTCACAGGCCA
G
AGGTGCAATATTGACATTGATGAGTGTGCCTCCAACCCCTGTCGCAAGGGTGCGACGTGCATCAATGAT
GTG
AATGGTTTCCGGTGTATATGCCCCGAGGGACCGCATCATCCTAGCTGCTACTCACAGGTGAACGAGT
GC
CTGAGCAATCCCTGCATCCACGGAAACTGTACTGGAGGTCTCAGTGGCTATAAGTGCCTCTGCGATGC
A
GGCTGGGTTGGTGTCAACTGTGAGGTGGACAAAAATGAGTGTCTTTCTAACCCATGCCAGAATGGAGGA
ACG
TGCAATAACCTGGTGAATGGCTACAGGTGTACCTGCAAGAAGGGGTTCAAAGGCTACAACTGCCAGG
TG
AATATAGATGAGTGTGCCTCCAACCCGTGTCTGAACCAAGGAACCTGCTTTGATGACGTCAGTGGCTA
C
ACTTGCCACTGCATGTTGCCTTACACAGGCAAGAACTGTCAAACAGTGTTGGCTCCCTGTTCCCCAAAC
CCG
TGTGAGAATGCTGCTGTTTGTAAAGAGGCACCCAATTTTGAGAGCTTCAGCTGCTTGTGTGCTCCTG
GC
TGGCAAGGTAAACGATGTACAGTTGACGTTGATGAGTGTATCTCCAAGCCGTGTATGAACAATGGTGT
C
TGCCACAACACTCAGGGCAGCTACGTGTGTGAGTGTCCTCCCGGCTTCAGTGGGATGGACTGTGAAGAG
GAC
ATCAATGATTGCCTTGCCAACCCCTGCCAGAACGGAGGCTCCTGTGTGGACCATGTGAATACCTTCT
CC
TGCCAGTGCCATCCTGGCTTCATAGGGGACAAGTGCCAGACAGACATGAATGAGTGTCTGAGCGAGCC
C
TGTAAGAATGGGGGGACCTGCTCCGACTATGTCAACAGTTACACCTGCACATGCCCTGCGGGCTTCCAC
GGA
GTCCACTGTGAAAACAACATTGACGAGTGCACTGAGAGCTCCTGCTTCAATGGCGGCACGTGTGTTG
AT
GGAATCAACTCTTTCTCTTGCTTGTGCCCCGTGGGTTTCACTGGTCCCTTCTGCCTCCATGATATCAA
T
GAGTGCAGCTCTAACCCGTGCCTGAATGCTGGAACGTGTGTTGATGGTCTGGGTACCTACCGATGCATC
TGT
CCCTTGGGCTACACCGGGAAAAACTGTCAGACCCTGGTGAACCTCTGCAGCCGGTCTCCGTGTAAAA
AC
AAAGGAACTTGTGTTCAGGAAAAGGCAAGGCCCCACTGTCTGTGTCCGCCTGGATGGGATGGTGCATA
C
TGTGATGTGCTCAACGTGTCCTGTAAGGCGGCAGCCTTGCAGAAAGGAGTACCTGTTGAACACTTGTGC
CAG
CACTCGGGCATCTGTATCAATGCTGGCAACACCCATCACTGCCAGTGCCCCCTGGGCTACACGGGGA
GC
TACTGCGAGGAGCAGCTTGATGAGTGTGCATCCAATCCATGCCAGCACGGTGCCACCTGCAATGACTT
C
ATCGGAGGATACAGATGTGAGTGTGTTCCAGGATATCAGGGTGTCAACTGTGAGTATGAAGTGGACGAG
TGC
CAGAACCAACCCTGCCAGAATGGAGGCACCTGCATCGACCTTGTGAACCATTTCAAGTGTTCGTGTC
CC
CCAGGCACCCGGGGCCTGCTGTGTGAAGAGAACATCGATGAATGTGCTGGGGGCCCCCACTGCCTTAA
C
GGTGGCCAGTGCGTGGACCGGATTGGAGGCTACACTTGTCGCTGTTTGCCTGGCTTTGCTGGGGAGCGG
TGT
GAGGGGGACATCAACGAATGCCTGTCCAACCCTTGCAGCTCAGAGGGCAGCCTGGACTGCGTTCAGC
TC
AAAAATAACTACAACTGTATCTGCCGCAGCGCCTTCACGGGCCGGCACTGTGAAACCTTCCTAGATGT
G
TGTCCCCAGAAGCCTTGCCTGAACGGAGGGACTTGTGCCGTGGCTAGCAACATGCCCGATGGCTTCATC
TGT
CGTTGTCCCCCAGGGTTCTCTGGGGCGAGATGCCAGAGCAGCTGTGGACAAGTGAAGTGCAGGAGAG
GG
GAGCAGTGTATCCACACTGACTCGGGACCTCGCTGCTTCTGCCTGAACCCCAAGGACTGCGAGTCAGG
A
TGTGCCAGTAACCCCTGCCAGCATGGGGGCACCTGCTATCCTCAGCGCCAGCCTCCTCACTATTCCTGC
CGC
TGCCCTCCGTCGTTCGGGGGCAGCCACTGCGAACTCTACACAGCCCCCACCAGCACCCCTCCTGCTA
CC
TGTCAGAGTCAGTACTGCGCCGACAAGGCTCGGGATGGCATCTGTGACGAGGCCTGCAATAGTCATGC
C
TGCCAGTGGGATGGAGGTGACTGTTCCCTCACTATGGAGGACCCCTGGGCCAACTGCACCTCCACTCTT
CGC
TGCTGGGAATACATCAACAACCAGTGTGATGAGCAGTGCAACACCGCAGAGTGCCTGTTTGACAACT
TT
GAGTGCCAGAGGAATAGCAAGACGTGCAAGTATGACAAATACTGTGCAGACCACTTCAAAGACAACCA
C
TGTGATCAGGGATGCAACAGCGAGGAGTGTGGCTGGGATGGGCTGGACTGCGCTTCGGACCAGCCTGAG
AAC
CTGGCAGAGGGCACCCTGATCATCGTGGTGCTCCTGCCCCCTGAACAGCTGCTGCAGGATTCGCGAA
GC
TTCTTGAGGGCCCTGGGCACCCTGCTCCACACCAACTTGCGCATTAAACAAGATTCTCAGGGCGCTCT
C
ATGGTGTACCCCTACTTTGGGGAGAAGTCAGCTGCCATGAAGAAGCAGAAGATGACACGCAGGTCTCTT
CCT
GAGGAGCAGGAGCAGGAGCAGGAGGTGATAGGCTCTAAGATATTTCTGGAGATCGACAACCGACAGT
GT
GTTCAAGATTCAGACCAGTGCTTCAAAAACACAGATGCGGCAGCTGCTCTCCTGGCTTCTCATGCCAT
C
CAAGGGACCCTATCCTACCCTCTAGTGTCTGTTTTCAGTGAACTGGAGAGTCCAAGAAACGCCCAGCTT
CTC
TATCTGCTCGCGGTCGCTGTTGTCATCATCCTGTTCTTCATCCTGCTGGGGGTCATCATGGCCAAGC
GG
AAGCGCAAGCATGGCTTCCTCTGGCTGCCGGAAGGGTTCACCCTCCGCCGAGACTCTAGCAATCACAA
G
CGCCGTGAACCTGTGGGACAGGATGCCGTGGGGCTGAAAAATCTCTCCGTGCAAGTGTCAGAGGCTAAC
CTG
ATTGGTTCTGGGACAAGTGAACATTGGGTTGATGATGAAGGACCCCAGCCAAAGAAAGCCAAGGCTG
AG
GATGAGGCTTTGCTGTCGGAAGATGACCCCATCGATCGACGGCCCTGGACACAGCAGCACCTTGAAGC
T
GCAGACATCCGCCACACTCCATCCCTGGCACTCACTCCTCCTCAGGCAGAACAGGAGGTGGACGTGCTG
GAC
GTGAATGTCCGAGGCCCAGATGGGTGTACTCCACTGATGCTGGCTTCTCTCCGAGGAGGCAGCTCAG
AC
CTGAGTGATGAAGACGAAGATGCTGAGGACTCTTCTGCCAACATCATCACAGACTTGGTCTACCAAGG
T
GCCAGCCTTCAAGCACAGACAGACCGCACTGGCGAGATGGCCCTGCACCTTGCAGCCCGCTATTCGAGA
GCT
GATGCTGCCAAACGCCTCCTGGATGCTGGTGCGGATGCAAATGCCCAGGACAACATGGGCCGATGTC
CT
CTTCACGCTGCGGTGGCAGCAGACGCCCAAGGTGTCTTTCAGATTCTGATCCGCAACCGTGTAACCGA
T
CTGGATGCCAGAATGAACGATGGTACTACCCCCCTGATCCTGGCTGCCCGCCTGGCTGTGGAAGGAATG
GTG
GCAGAGTTGATCAATTGCCAAGCAGATGTCAATGCAGTGGATGACCATGGAAAATCTGCCCTCCACT
GG
GCAGCTGCTGTCAATAATGTGGAGGCGACTCTTCTGCTGTTGAAGAATGGGGCCAACAGAGATATGCA
G
GACAATAAGGAAGAGACACCTTTGTTTCTTGCTGCCCGAGAGGGAAGTTATGAAGCGGCCAAAATCCTG
TTA
GACCATTTTGCCAACCGGGACATCACTGACCACATGGACCGCCTTCCCCGGGATGTGGCTCGGGACC
GC
ATGCACCATGACATCGTTCGCCTCCTGGACGAGTATAACGTGACTCCCAGCCCTCCGGGAACGGTCTT
G
ACTTCTGCGCTCTCACCTGTCCTCTGTGGGCCCAACAGGTCTTTCCTCAGTCTGAAGCACACCCCAATG
GGT
AAGAAGGCTAGGCGGCCCAACACCAAGAGCACCATGCCCACGAGCCTGCCTAACCTTGCCAAGGAGG
CC
AAGGATGCCAAGGGCAGCAGGAGGAAGAAGTGTCTGAACGAGAAGGTCCAGCTGTCCGAGAGCTCAGT
G
ACTCTATCCCCCGTCGATTCGCTCGAGTCTCCTCACACGTATGTCTCCGATGCCACATCCTCTCCCATG
ATC
ACATCCCCTGGAATCTTACAGGCCTCGCCCACCCCCCTGCTGGCTGCTGCCGCCCCGGCTGCCCCAG
TG
CACACACAGCATGCGCTGTCTTTCTCTAACCTTCATGACATGCAGCCTTTGGCTCCTGGAGCCAGCAC
C
GTGCTCCCCTCGGTCAGCCAGCTGCTATCCCACCACCACATCGCGCCCCCAGGTAGTAGCAGTGCAGGA
AGC
TTGGGCAGGTTACATCCAGTTCCTGTCCCAGCAGACTGGATGAACCGTGTGGAGATGAACGAGACCC
AG
TACAGTGAAATGTTTGGCATGGTCCTGGCTCCTGCAGAGGGAGCCCACCCTGGCATAGCAGCTCCCCA
G
AGCAGACCTCCGGAAGGGAAGCACATGTCCACCCAGCGGGAGCCCTTGCCTCCCATCGTGACTTTCCAG
CTT
ATCCCAAAAGGCAGCATTGCCCAGGCAGCCGGAGCTCCCCAGACGCAGTCCAGTTGCCCTCCAGCTG
TT
GCAGGCCCCTTGCCCTCTATGTACCAGATCCCAGAGATGCCCCGTTTGCCCAGTGTGGCTTTCCCACC
T
ACCATGATGCCCCAGCAGGAGGGGCAGGTAGCTCAGACCATTGTGCCAACCTATCATCCTTTCCCAGCC
TCT
GTGGGCAAGTACCCCACACCCCCTTCCCAACACAGTTACGCCTCCTCAAATGCTGCTGAGCGAACCC
CC
AGTCATGGTGGTCACCTCCAGGGCGAGCACCCATACCTGACACCATCCCCAGAGTCTCCTGACCAATG
G
TCAAGCTCTTCACCACACTCTGCATCTGACTGGTCAGATGTGACCACCAGCCCAACTCCTGGAGGTGGT
GGA
GGCGGTCAGCGGGGACCCGGAACACACATGTCCGAGCCACCACACAGCAACATGCAGGTGTATGCAT
GA


Translation (2473 aa):
MPALRPAALRALLWLWLCGAGPAHALQCRGGQEPCVNEGTCVTYHNGTGFCRCPEGFLGEYCQHRDPCEK
N
RCQNGGTCVPQGMLGKATCRCAPGFTGEDCQYSTSHPCFVSRPCQNGGTCHMLSRDTYECTCQVGFT
GK
Q
CQWTDACLSHPCENGSTCTSVASQFSCKCPAGLTGQKCEADINECDIPGRCQHGGTCLNLPGSYRCQCP
Q
GFTGQHCDSPYVPCAPSPCVNGGTCRQTGDFTFECNCLP
GFEGSTCERNIDDCPNHKCQNGGVCVDGVN
T
YNCRCPPQWT
GQFCTEDVDECLLQPNACQNGGTCTNRNGGYGCVCVNGWSGDDCSENIDDCAYASCTPG
S
TCIDRVASFSCLCPEGKA
GLLCHLDDACISNPCHKGALCDTNPLNGQYICTCPQGYKGADCTEDVDECA
M
ANSNPCEHAGKCVNTDGAFHCECLKGYAGPRCEMDINECHSDPCQNDATCLDKIGGFTCLCMPGFKGVH
C
ELEVNECQSNPCVNNGQCVDKVNRFQCLCPP
GFTGPVCQIDIDDCSSTPCLNGAKCIDHPNGYECQCAT
G
FTGILCDENIDNCDPDPCHHGQCQDGIDSYTCICNPGYMGAICSDQIDECYSSPCLNDGRCIDLVNGYQ
C
NCQPGTS
GLNCEINFDDCASNPCMHGVCVDGINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCIND
V
NGFRCICPEGPHHPSCYSQVNECLSNPCIHGNCTGGLS
GYKCLCDAGWVGVNCEVDKNECLSNPCQNGG
T
CNNLVNGYRCTCKKGFK
GYNCQVNIDECASNPCLNQGTCFDDVSGYTCHCMLPYTGKNCQTVLAPCSPN
P
CENAAVCKEAPNFESFSCLCAPGWQ
GKRCTVDVDECISKPCMNNGVCHNTQGSYVCECPPGFSGMDCEE
D
INDCLA
NPCQNGGSCVDHVNTFSCQCHPGFIGDKCQTDMNECLSEPCKNGGTCSDYVNSYTCTCPAGFH
G
VHCENNIDECTE
SSCFNGGTCVDGINSFSCLCPVGFTGPFCLHDINECSSNPCLNAGTCVDGLGTYRCI
C
PLGYTGKNCQ
TLVNLCSRSPCKNKGTCVQEKARPHCLCPPGWDGAYCDVLNVSCKAAALQKGVPVEHLC
Q
HSGICINAGNTHHCQCPLGYTGSYCEEQLDECASNPCQHGATCNDFIGGYRCE
CVPGYQGVNCEYEVDE
C
QNQPCQNGGTCIDLVNHFKCSCPPGTR
GLLCEENIDECAGGPHCLNGGQCVDRIGGYTCRCLPGFAGER
C
EGDINECLSNPCSSEGSLDCVQLKNNYNCICRSAFT
GRHCETFLDVCPQKPCLNGGTCAVASNMPDGFI
C
RCPP
GFSGARCQSSCGQVKCRRGEQCIHTDSGPRCFCLNPKDCESGCASNPCQHGGTCYPQRQPPHYSC
R
CPPSFGGSHCELYTAPTSTPPATCQSQYCADKARDGICDEACNSHACQWDGGDCSLTMEDPWANCTSTL
R
CWEYINNQCDEQCNTAECLFDNFECQRNSKTC
KYDKYCADHFKDNHCDQGCNSEECGWDGLDCASDQPE
N
LAEGTLIIVVLLPPEQLLQDSRSFLRALGTLLHTNLRIKQDSQGALMVYPYFGEKSAAMKKQKMTRRSL
P
EEQEQEQEVI
GSKIFLEIDNRQCVQDSDQCFKNTDAAAALLASHAIQGTLSYPLVSVFSELESPRNAQL
L
YLLAVAVVIILFFILLGVIMAKRKRKHGFLWLPEGFTLRRDSSNHKRREPVGQDAVGL
KNLSVQVSEAN
L
IGSGTSEHWVDDEGPQPKKAK
AEDEALLSEDDPIDRRPWTQQHLEAADIRHTPSLALTPPQAEQEVDVL
D
VNVRGP
DGCTPLMLASLRGGSSDLSDEDEDAEDSSANIITDLVYQGASLQAQTDRTGEMALHLAARYSR
A
DAAKRLLDAGADANAQDNMGRCPLHAAVAADAQGVFQ
ILIRNRVTDLDARMNDGTTPLILAARLAVEGM
V
AELINCQADVNAVDDH
GKSALHWAAAVNNVEATLLLLKNGANRDMQDNKEETPLFLAAREGSYEAAKIL
L
DHFANRDITDHMDRLPRDVARDRMHHDIVRLLDEYNVTPSPPGTVLTSALSPVLCGPNRSFLSLKHTPM
G
KKARRPNTKSTMPTSLPNLAKEAKDAKGSRRKKCLNEKVQLSESSVTLSPVDSLESPHTYVSDATSSPM
I
TSPGILQASPTPLLAAAAPAAPVHTQHALSFSNLHDMQPLAPGASTVLPSVSQLLSHHHIAPPGSSSAG
S
LGRLHPVPVPADWMNRVEMNETQYSEMFGMVLAPAEGAHPGIAAPQSRPPEGKHMSTQREPLPPIVTFQ
L
IPKGSIAQAAGAPQTQSSCPPAVAGPLPSMYQIPEMPRLPSVAFPPTMMPQQEGQVAQTIVPTYHPFPA
S
VGKYPTPPSQHSYASSNAAERTPSHGGHLQGEHPYLTPSPESPDQWSSSSPHSASDWSDVTTSPTPGGG
G
GGQRGPGTHMSEPPHSNMQVYA




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser