NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS24184.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
24184.1 Public Mus musculus 10 Kcnmb4 21 106 86 CCDS HistoryNCBI Gene:58802Re-query CCDS DB by CCDS ID:24184.1Re-query CCDS DB by GeneID:58802See the combined annotation on chromosome 10 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 24184.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000068233 ENSMUSP00000065384 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000068233Link to Ensembl Protein Viewer:ENSMUSP00000065384Re-query CCDS DB by Nucleotide ID:ENSMUST00000068233Re-query CCDS DB by Protein ID:ENSMUSP00000065384
Original member Current member EBI,WTSI OTTMUST00000093773 OTTMUSP00000052095 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000093773Link to Vega Protein Viewer:OTTMUSP00000052095Re-query CCDS DB by Nucleotide ID:OTTMUST00000093773Re-query CCDS DB by Protein ID:OTTMUSP00000052095
Original member Current member NCBI NM_021452.1 NP_067427.1 Accepted alive Link to Nucleotide Sequence:NM_021452.1Link to Protein Sequence:NP_067427.1Re-query CCDS DB by Nucleotide ID:NM_021452Re-query CCDS DB by Protein ID:NP_067427Link to BLAST:NP_067427.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_067427.1 210 Q9JIN6 210 100% 0 0

Chromosomal Locations for CCDS 24184.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 10 (NC_000076.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 10Link to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 116418238 116418406 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 116446327 116446454 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 116473186 116473521 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (633 nt):
ATGGCGAAGCTCAGGGTGTCTTACGAGTACACGGAAGCCGAAGACAAGAGCATCCGGCTCGGCTTGTTCC
TC
ATCGTCTCCGGCATCCTGTCGCTCTTCATCTTCGGCTTCTGCTGGCTCAGTCCCGCCTTGCAGGATCT
G
CAAGCCACGGCGGCCAACTGCACCGTGCTGTCGGTGCAGCAGATCGGCGAGGTGTTCGAGTGCACCTTC
ACC
TGTGGCACCGACTGCAGGGGCACCTCGCAGTATCCCTGCGTCCAGGTGTACGTGAACAACTCCGAGT
CC
AACTCCAGGGCGCTGCTACACAGCGACCAGCACCAGCTCCTGACCAACCCCAAGTGCTCCTATATCCC
G
CCCTGTAAGAGAGAAAACCAGAAGAACTCGGAGAGCGTCATGAACTGGCAGCAGTATTGGAAAGATGAG
ATC
GGTTCCCAGCCATTCACTTGCTATTTTAATCAGCATCAGAGACCAGAGGACGTTCTCCTACAGCGCA
CA
CACGACGAGATTGCTCTCCTGCACTGCTTCCTCTGGCCGGTGGTGGCGTTTGTGGTGGGTGTTCTCAT
C
GTGGTCCTGACCATCTGTGCCAAGAGCCTGGCGGTCAAGGCGGAAGCCATGAAGAAACGCAAGTTCTCT
TAA


Translation (210 aa):
MAKLRVSYEYTEAEDKSIRLGLFLIVSGILSLFIFGFCWLSPALQDLQATAANCTVLSVQQIGEVFECTF
T
CGTDCRGTSQYPCVQVYVNNSESNSRALLHSDQHQLLTNPK
CSYIPPCKRENQKNSESVMNWQQYWKDE
I
GSQPFTCYFNQHQ
RPEDVLLQRTHDEIALLHCFLWPVVAFVVGVLIVVLTICAKSLAVKAEAMKKRKFS



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser