NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS30482.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
30482.1 Public Mus musculus X Ubqln2 21 106 86 CCDS HistoryNCBI Gene:54609Re-query CCDS DB by CCDS ID:30482.1Re-query CCDS DB by GeneID:54609See the combined annotation on chromosome X in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 30482.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000060714 ENSMUSP00000056888 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000060714Link to Ensembl Protein Viewer:ENSMUSP00000056888Re-query CCDS DB by Nucleotide ID:ENSMUST00000060714Re-query CCDS DB by Protein ID:ENSMUSP00000056888
Original member Current member EBI,WTSI OTTMUST00000046253 OTTMUSP00000020893 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000046253Link to Vega Protein Viewer:OTTMUSP00000020893Re-query CCDS DB by Nucleotide ID:OTTMUST00000046253Re-query CCDS DB by Protein ID:OTTMUSP00000020893
Original member Current member NCBI NM_018798.2 NP_061268.2 Accepted alive Link to Nucleotide Sequence:NM_018798.2Link to Protein Sequence:NP_061268.2Re-query CCDS DB by Nucleotide ID:NM_018798Re-query CCDS DB by Protein ID:NP_061268Link to BLink:NP_061268.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_061268.2 638 Q9QZM0 638 100% 0 0

Chromosomal Locations for CCDS 30482.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome X (NC_000086.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome XLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome XSee the combined annotation on chromosome X in Sequence Viewer

Chromosome Start Stop Links
X 153498454 153500370 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1917 nt):
ATGGCTGAGAACGGCGAGAGCAGCGGCCCCCCGCGCCCCTCCCGCGGCCCTGCGGCGGCCCCAGGCGCGG
CC
AGCCCGCCGGCCGAGCCCAAAATCATCAAAGTCACTGTGAAGACCCCCAAAGAGAAGGAGGAGTTCGC
G
GTGCCCGAGAACAGCACCGTGCAGCAGTTCAAGGAAGCGATTTCCAAACGCTTCAAATCGCAGACCGAT
CAG
CTCGTGCTGATTTTCGCCGGAAAGATCCTGAAAGATCAAGATACCTTGATGCAGCATGGCATCCATG
AT
GGACTGACTGTTCACCTGGTTATCAAAAGCCAGAACCGTCCGCAGGGCCAGGCCACCACGCAGCCCAG
C
ACGACTGCGGGAACGAGCACGACGACCACGACCACCACCACGGCGGCGGCGCCGGCGGCGACGACATCA
TCG
GCTCCCAGGAGTAGCTCCACACCTACCACCACGAATAGCAGCTCCTTTGGGCTGGGAAGCCTTTCCA
GC
CTTAGTAACCTGGGCTTGAACTCGCCCAACTTCACCGAGCTTCAGAACCAGATGCAGCAGCAGCTCCT
G
GCCAGCCCTGAGATGATGATCCAGATCATGGAAAATCCCTTTGTTCAGAGCATGCTTTCGAATCCTGAT
CTG
ATGAGGCAGCTCATCATGGCCAATCCACAGATGCAACAATTGATCCAGAGAAACCCAGAAATCAGCC
AC
CTACTGAACAACCCAGATATAATGAGGCAGACGCTGGAAATCGCCAGGAATCCTGCCATGATGCAAGA
G
ATGATGCGAAATCAAGACCTGGCTCTCAGTAATCTCGAAAGCATCCCAGGTGGCTACAATGCTCTGCGG
CGC
ATGTACACTGACATTCAAGAACCTATGCTGAATGCCGCACAGGAGCAGTTTGGGGGCAACCCGTTTG
CC
ACGGTGGGGAGCAGTTCCACCTCAGGGGAAGGTACTCAGCCCTCCCGCACGGAGAATCGTGATCCGCT
G
CCCAATCCTTGGGCACCACCGCCAACAACCCAGACGGCTGCGACCACCACCACCACCACGACCACAAGC
AGT
GGCAGTGGCTCTGGCAGCAGCTCCAGCAGCACCACCGCCGGGAACACCATGGCTGCAGCTAATTACG
TG
GCTAGCATCTTCAGCACCCCAGGAATGCAGAGCCTGCTGCAGCAGATAACTGAGAATCCCCAGCTGAT
T
CAGAATATGCTGTCTGCGCCCTACATGCGGAGCATGATGCAGTCGCTGAGCCAGAATCCAGATATGGCG
GCC
CAGATGATGCTGAGTAGCCCGCTGTTCACTTCGAATCCTCAGCTGCAGGAGCAGATGCGTCCACAGC
TC
CCGAATTTCCTGCAGCAGATGCAGAATCCAGAAACCATCGCGGCCATGTCAAACCCGAGAGCGATGCA
A
GCGCTAATGCAGATCCAGCAGGGGCTACAGACTCTAGCCACTGAAGCACCTGGCCTCATTCCCAGCTTC
GCT
CCAGGTGTGGGGATGGGAGTGCTGGGAACCGCCATAACCCCTGTGGGCCCAGTCACTCCCATAGGGC
CC
ATCGGCCCTATAGTTCCTTTCACCCCCATAGGCCCCATCGGGCCTATAGGACCCACTGGCCCTGCAAG
C
TCCCCCGGCTCCACCGGCACTGGCATCCCGCCTGCAACCACTGTGTCCAGCTCTGCACCTACTGAAACC
ATA
AGTCCAACCTCGGAATCTGGACCCAACCAGCAGTTCATTCAACAAATGGTGCAGGCTCTCACTGGAG
GA
AGCCCTCCACAGCCGCCGAATCCTGAAGTGAGATTTCAGCAGCAACTGGAACAGCTCAACGCCATGGG
G
TTCTTAAACCGCGAAGCAAACTTGCAGGCCCTAATAGCAACAGGAGGCGACATCAACGCGGCCATTGAG
AGG
CTGCTGGGCTCTCAGCCATCCTAA


Translation (638 aa):
MAENGESSGPPRPSRGPAAAPGAASPPAEPKIIKVTVKTPKEKEEFAVPENSTVQQFKEAISKRFKSQTD
Q
LVLIFAGKILKDQDTLMQHGIHDGLTVHLVIKSQNRPQGQATTQPSTTAGTSTTTTTTTTAAAPAATTS
S
APRSSSTPTTTNSSSFGLGSLSSLSNLGLNSPNFTELQNQMQQQLLASPEMMIQIMENPFVQSMLSNPD
L
MRQLIMANPQMQQLIQRNPEISHLLNNPDIMRQTLEIARNPAMMQEMMRNQDLALSNLESIPGGYNALR
R
MYTDIQEPMLNAAQEQFGGNPFATVGSSSTSGEGTQPSRTENRDPLPNPWAPPPTTQTAATTTTTTTTS
S
GSGSGSSSSSTTAGNTMAAANYVASIFSTPGMQSLLQQITENPQLIQNMLSAPYMRSMMQSLSQNPDMA
A
QMMLSSPLFTSNPQLQEQMRPQLPNFLQQMQNPETIAAMSNPRAMQALMQIQQGLQTLATEAPGLIPSF
A
PGVGMGVLGTAITPVGPVTPIGPIGPIVPFTPIGPIGPIGPTGPASSPGSTGTGIPPATTVSSSAPTET
I
SPTSESGPNQQFIQQMVQALTGGSPPQPPNPEVRFQQQLEQLNAMGFLNREANLQALIATGGDINAAIE
R
LLGSQPS




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser