NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS23696.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
23696.1 Public Mus musculus 10 Grm1 21 106 86 CCDS HistoryNCBI Gene:14816Re-query CCDS DB by CCDS ID:23696.1Re-query CCDS DB by GeneID:14816See the combined annotation on chromosome 10 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 23696.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000044306 ENSMUSP00000037255 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000044306Link to Ensembl Protein Viewer:ENSMUSP00000037255Re-query CCDS DB by Nucleotide ID:ENSMUST00000044306Re-query CCDS DB by Protein ID:ENSMUSP00000037255
Original member Current member EBI,WTSI OTTMUST00000039039 OTTMUSP00000017441 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000039039Link to Vega Protein Viewer:OTTMUSP00000017441Re-query CCDS DB by Nucleotide ID:OTTMUST00000039039Re-query CCDS DB by Protein ID:OTTMUSP00000017441
Original member Current member NCBI NM_016976.3 NP_058672.1 Accepted alive Link to Nucleotide Sequence:NM_016976.3Link to Protein Sequence:NP_058672.1Re-query CCDS DB by Nucleotide ID:NM_016976Re-query CCDS DB by Protein ID:NP_058672Link to BLink:NP_058672.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_058672.1 1199 P97772-1 1199 100% 0 0

Chromosomal Locations for CCDS 23696.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 10 (NC_000076.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 10Link to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 10688963 10689902 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 10719223 10720153 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 10733159 10733285 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 10741436 10741604 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 10746545 10746791 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 10782559 10782794 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 10936329 10936578 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 11079839 11080538 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3600 nt):
ATGGTCCGGCTCCTCTTGATTTTCTTCCCAATGATCTTTTTGGAGATGTCCATTTTGCCCAGGATGCCTG
AC
AGAAAAGTACTGCTGGCAGGTGCCTCGTCCCAGCGCTCTGTGGCGAGAATGGACGGAGATGTCATCAT
C
GGAGCCCTCTTCTCAGTCCATCACCAGCCTCCAGCCGAAAAGGTACCGGAAAGGAAGTGTGGGGAGATC
AGA
GAACAGTATGGTATCCAGAGAGTGGAGGCCATGTTCCACACATTAGATAAGATTAATGCGGACCCGG
TG
CTCCTGCCCAACATCACTCTGGGCAGTGAGATCCGGGACTCCTGCTGGCACTCTTCTGTGGCTCTGGA
A
CAGAGCATTGAGTTCATCAGAGACTCCCTGATTTCCATCCGAGATGAGAAGGATGGACTGAACCGCTGC
CTG
CCTGATGGCCAGACCCTACCCCCAGGCAGGACTAAGAAGCCTATTGCTGGAGTGATCGGCCCTGGCT
CC
AGCTCTGTGGCCATTCAAGTCCAGAATCTTCTGCAGCTGTTCGACATCCCACAAATCGCCTATTCTGC
C
ACGAGCATAGACCTGAGCGACAAAACTTTGTACAAATACTTCCTGAGGGTGGTCCCTTCTGACACTTTG
CAG
GCAAGGGCGATGCTTGATATCGTCAAGCGGTACAACTGGACCTATGTCTCTGCAGTCCACACAGAAG
GG
AATTACGGCGAGAGTGGAATGGATGCTTTCAAAGAGTTGGCTGCCCAGGAAGGACTCTGCATCGCACA
C
TCGGACAAAATCTACAGCAATGCTGGCGAGAAGAGCTTTGATCGGCTTCTGCGCAAGCTCCGAGAGCGG
CTT
CCCAAGGCCAGGGTTGTGGTCTGCTTCTGCGAGGGCATGACAGTGCGGGGGTTACTGAGTGCCATGC
GC
CGCCTTGGCGTCGTGGGAGAGTTCTCACTCATTGGAAGTGATGGATGGGCAGACAGAGATGAAGTCAT
C
GAAGGCTATGAGGTGGAAGCCAATGGGGGAATCACAATAAAGCTGCAGTCTCCAGAGGTCAGGTCGTTT
GAT
GACTACTTTCTGAAGCTGAGGCTGGACACCAACACGAGGAATCCTTGGTTCCCTGAGTTCTGGCAAC
AT
CGCTTCCAGTGTCGCCTACCTGGACACCTCTTGGAAAACCCCAACTTTAAAAAAGTCTGCACAGGAAA
T
GAAAGCTTGGAAGAAAATTATGTCCAGGACAGCAAAATGGGATTTGTCATCAACGCCATCTATGCCATG
GCA
CACGGCCTACAGAACATGCACCATGCTCTATGTCCTGGCTACGTGGGCCTTTGTGATGCCATGAAGC
CC
ATTGACGGCAGGAAGCTCCTGGATTTCCTCATCAAATCCTCTTTTGTTGGAGTGTCTGGAGAGGAGGT
C
TGGTTCGATGAGAAGGGGGATGCACCTGGAAGGTATGACATTATGAATCTGCAGTACACAGAGGCTAAT
CGC
TATGACTATGTCCATGTGGGAACCTGGCATGAAGGTGTGCTGAATATCGATGATTACAAAATCCAGA
TG
AACAAAAGCGGAATGGTACGATCTGTGTGCAGCGAGCCTTGCTTAAAGGGTCAGATTAAGGTCATACG
G
AAAGGGGAAGTGAGCTGCTGCTGGATCTGCACAGCCTGCAAAGAGAATGAGTTTGTGCAAGATGAGTTT
ACC
TGCAGAGCCTGTGACCTGGGGTGGTGGCCCAATGCAGAGCTCACAGGCTGTGAGCCCATTACTATCC
GT
TACCTCGAGTGGAGTGACATAGAATCCATCATAGCCATCGCCTTTTCTTGCCTGGGCATCCTCGTGAC
G
CTATTTGTCACCCTCATCTTTGTGCTGTACCGGGACACACCTGTGGTCAAATCCTCCAGTAGAGAGCTC
TGC
TATATCATTCTGGCTGGTATTTTCCTCGGCTACGTATGCCCTTTCACCCTCATCGCCAAACCTACTA
CC
ACATCCTGCTACCTCCAGCGCCTCCTAGTTGGCCTCTCTTCTGCCATGTGCTACTCTGCTCTTGTGAC
C
AAAACCAATCGTATTGCACGCATCCTGGCTGGCAGCAAGAAGAAGATCTGTACCCGGAAGCCCAGGTTC
ATG
AGCGCTTGGGCCCAAGTGATCATAGCCTCCATTCTGATTAGTGTACAGCTGACACTAGTGGTGACCT
TG
ATCATCATGGAGCCTCCCATGCCCATTTTGTCCTACCCGAGCATCAAGGAAGTCTATCTTATCTGCAA
T
ACCAGCAACCTGGGTGTAGTGGCACCTGTGGGTTACAACGGACTTCTCATCATGAGCTGTACCTACTAT
GCC
TTCAAGACCCGCAACGTGCCGGCCAATTTCAATGAGGCTAAATACATCGCCTTCACTATGTACACCA
CC
TGCATCATCTGGCTGGCTTTTGTTCCCATTTACTTTGGGAGCAACTACAAGATTATCACTACCTGCTT
C
GCAGTGAGCCTCAGTGTGACGGTGGCCCTGGGCTGCATGTTCACTCCCAAGATGTACATCATTATTGCC
AAA
CCCGAGAGGAATGTCCGCAGTGCCTTCACCACCTCTGATGTAGTGCGCATGCACGTCGGTGACGGCA
AG
CTGCCATGCCGCTCCAACACCTTCCTCAACATTTTCCGGAGAAAGAAGCCTGGGGCAGGGAACGCCAA
T
TCTAACGGCAAGTCTGTGTCATGGTCTGAACCAGGTGGAAGACAGGCGCCCAAGGGACAGCATGTGTGG
CAG
CGCCTCTCTGTGCACGTGAAGACCAATGAGACGGCCTGTAACCAAACAGCCGTAATTAAACCCCTCA
CT
AAAAGTTACCAAGGCTCTGGCAAGAGTCTGACCTTTTCAGACGCCAGCACCAAGACCCTTTACAACGT
G
GAGGAAGAGGACAATACCCCTTCAACTCACTTCAGCCCTCCCAGCAGCCCTTCCATGGTGGTGCACCGA
CGC
GGGCCACCCGTGGCCACCACGCCACCTCTGCCACCCCACCTTAGCGCAGAAGAGACGCCCTTGTTCC
TG
GCTGATTCTGTCATCCCCAAGGGCTTGCCTCCTCCTCTCCCGCAGCAGCAACAGCAGCCGCCCCCTCA
G
CCGCCTCCGCAGCAGCCCAAATCCCTGATGGACCAGCTGCAAGGCGTGGTCACCAACTTTGGCTCTGGG
ATT
CCAGACTTCCACGCGGTGCTGGCAGGCCCGGGGACACCAGGGAACGGGCTGCGCTCCCTGTACCCGC
CC
CCGCCTCCACCGCAACACCTGCAGATGTTGCCCCTGCAGCTGAGCACCTTCCGAGAGGAGCCCATCTC
C
CCTCCGGGGGAGGACGACGATGATGACAGCAGCGAGAGGTTCAAGCTCCTGCAGGAGTTCGTGTATGAG
CGT
GAAGGGAACACGGAGGAAGACGATCTGGAAGAGGAGGAGGACCTGCCTGCAGCCAGCAAGCTGACGC
CT
GAGGATTCGCCTGCCCTGACGCCCCCTTCTCCTTTCCGAGATTCCGTGGCCTCTGGCAGCTCAGTGCC
C
AGTTCCCCAGTGTCTGAGTCAGTGCTCTGCACCCCTCCAAATGTGACCTATGCCTCTGTCATTCTGAGG
GAC
TACAAGCAAAGCTCTTCCACTCTGTAG


Translation (1199 aa):
MVRLLLIFFPMIFLEMSILPRMPDRKVLLAGASSQRSVARMDGDVIIGALFSVHHQPPAEKVPERKCGEI
R
EQYGIQRVEAMFHTLDKINADPVLLPNITLGSEIRDSCWHSSVALEQSIEFIRDSLISIRDEKDGLNRC
L
PDGQTLPPGRTKKPIAGVIGPGSSSVAIQVQNLLQLFDIPQIAYSATSIDLSDKTLYKYFLRVVPSDTL
Q
ARAMLDIVKRYNWTYVSAVHTE
GNYGESGMDAFKELAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRER
L
PKARVVVCFCEGMTVRGLLSAMRRLGVVGEFSLIG
SDGWADRDEVIEGYEVEANGGITIKLQSPEVRSF
D
DYFLKLRLDTNTRNPWFPEFWQHRFQCRLPGHLLENPNFKKVCT
GNESLEENYVQDSKMGFVINAIYAM
A
HGLQNMHHALCPGYVGLCDAMKPIDGRKLLDFLIKSSFVGVSGEEVWFDEKGDAPG
RYDIMNLQYTEAN
R
YDYVHVGTWHEGVLNIDDYKIQMNKSGMVRSVCSEPCLKGQIK
VIRKGEVSCCWICTACKENEFVQDEF
T
CRACDLGWWPNAELT
GCEPITIRYLEWSDIESIIAIAFSCLGILVTLFVTLIFVLYRDTPVVKSSSREL
C
YIILAGIFLGYVCPFTLIAKPTTTSCYLQRLLVGLSSAMCYSALVTKTNRIARILAGSKKKICTRKPRF
M
SAWAQVIIASILISVQLTLVVTLIIMEPPMPILSYPSIKEVYLICNTSNLGVVAPVGYNGLLIMSCTYY
A
FKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITTCFAVSLSVTVALGCMFTPKMYIIIA
K
PERNVRSAFTTSDVVRMHVGDGKLPCRSNTFLNIFRRKKPGAGNA
NSNGKSVSWSEPGGRQAPKGQHVW
Q
RLSVHVKTNETACNQTAVIKPLTKSYQGSGKSLTFSDASTKTLYNVEEEDNTPSTHFSPPSSPSMVVHR
R
GPPVATTPPLPPHLSAEETPLFLADSVIPKGLPPPLPQQQQQPPPQPPPQQPKSLMDQLQGVVTNFGSG
I
PDFHAVLAGPGTPGNGLRSLYPPPPPPQHLQMLPLQLSTFREEPISPPGEDDDDDSSERFKLLQEFVYE
R
EGNTEEDDLEEEEDLPAASKLTPEDSPALTPPSPFRDSVASGSSVPSSPVSESVLCTPPNVTYASVILR
D
YKQSSSTL




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser