NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS30330.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
30330.1 Public Mus musculus X Slc16a2 21 106 86 CCDS HistoryNCBI Gene:20502Re-query CCDS DB by CCDS ID:30330.1Re-query CCDS DB by GeneID:20502See the combined annotation on chromosome X in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 30330.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000042664 ENSMUSP00000037629 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000042664Link to Ensembl Protein Viewer:ENSMUSP00000037629Re-query CCDS DB by Nucleotide ID:ENSMUST00000042664Re-query CCDS DB by Protein ID:ENSMUSP00000037629
Original member Current member EBI,WTSI OTTMUST00000044352 OTTMUSP00000019930 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000044352Link to Vega Protein Viewer:OTTMUSP00000019930Re-query CCDS DB by Nucleotide ID:OTTMUST00000044352Re-query CCDS DB by Protein ID:OTTMUSP00000019930
Original member Current member NCBI NM_009197.2 NP_033223.2 Accepted alive Link to Nucleotide Sequence:NM_009197.2Link to Protein Sequence:NP_033223.2Re-query CCDS DB by Nucleotide ID:NM_009197Re-query CCDS DB by Protein ID:NP_033223Link to BLAST:NP_033223.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_033223.2 545 O70324 545 100% 0 0

Chromosomal Locations for CCDS 30330.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome X (NC_000086.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome XSee the combined annotation on chromosome X in Sequence Viewer

Chromosome Start Stop Links
X 103699747 103699967 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 103701492 103701720 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 103706252 103706395 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 103707755 103708205 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 103712159 103712303 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 103821355 103821802 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1638 nt):
ATGGCGCTGCCAAGCCCGGCGAGCGAGGAAGCTGAGGGGCCCTGTCAGGAGGCAAACCAGGAATATCAGG
AG
CCGGTGTGTAGTCCTGTGCCCGAGCCGGAGCCAGAGCCGGAGCCCGAACCGGAGCCTGACCCCGAGCC
G
GTGCCAGTGCCCCCGCCCGAGCCTCAGCCTGAGCCCGAGCCCCAGCCCCTACCCGATCCTGCACCCCTG
CCG
GAGCTGGGCTTTGAGGCTGAGCCAGTGCAAGAACCCGAGCCCACGCCCACTGTGGAAACCCGAGGCA
CC
GCGCGTGGCTTTCAGCCTCCCGAAGGTGGCTTCGGCTGGATAGTGGTGTTTGCAGCCACCTGGTGCAA
C
GGCTCCATCTTCGGCATCCATAACTCTGTTGGTATCCTCTACTCCATGCTACTAGAGGAGGAAAAAGAG
AAA
AATCGCCAAGTGGAGTTCCAAGCAGCATGGGTCGGAGCCCTCGCTATGGGCATGATCTTCTTCTGTT
CT
CCCATTGTGAGTATATTCACTGACCGTTTGGGCTGCCGAATCACAGCCACCACCGGGGCCGCTGTTGC
T
TTCATTGGCCTCCACACCAGCTCCTTCACCAGCTCCCTAAGCCTGCGCTACTTCACCTATGGGATTCTG
TTT
GGTTGTGGCTGCTCATTCGCCTTTCAACCATCACTCGTCATCCTGGGCCACTACTTTCAACGTCGCC
TA
GGTCTAGCCAATGGTGTGGTATCTGCTGGAAGTAGCATCTTCTCCATGTCTTTTCCCTTCCTCATCAA
A
ATGCTGGGGGATAAAATCAAGCTGGCCCAAACCTTCCAGGTGCTGAGTACCTTCATGTTTGTCCTTACG
CTG
CTCTCACTCACTTACCGGCCCCTCCTGCCAAGCTCCCAGGACACCCCAAGCAAGAGAGGTGCCCACA
CC
CTGCGACAGCGCTTTCTGGTTCAGTTCAGAAAGTACTTCAACATGCGTGTATTCCGCCAGCGCACTTA
C
CGTATCTGGGCCTTTGGGATCGCTGCTGCTGCCCTTGGTTACTTCGTCCCCTACGTGCACCTGATGAAA
TAT
GTGGAAGATAAGTTCAAGGAGATCAAGGAGACCTGGGTGCTCTTGGTGTGCATTGGGGCTACGTCAG
GC
CTCGGACGTCTCGTCTCGGGCCACATCAGTGACTCCATCCCTGGACTTAAGAAGATATACTTGCAGGT
C
CTCTCATTCCTGCTCCTGGGCTTGATGTCCATGATGATCCCCCTATGCCGGGACTTCGGGGGCCTTATC
GTT
GTCTGCCTCTTCCTGGGCCTATGTGATGGCTTCTTCATTACCATCATGGCTCCCATTGCATTTGAGC
TG
GTGGGACCCATGCAGGCCTCACAGGCCATTGGCTACCTCCTGGGCATGATGGCCCTGCCAATGATTGC
T
GGGCCCCCCATTGCAGGCCTCCTTCGAAACTGCTTTGGTGATTACCATGTGGCCTTCTACTTTGCGGGT
GTC
CCCCCAATCATTGGAGCTGTGATCCTTTTCTTCGTCCCTCTGATGCATCAAAGGATGTTTAAGAAAG
AG
CAGAGAGATTCCAGCAAGGATAAGATGCTGTCCCACGATCCAGACCCCAACGGAGAACTGCTGCCAGG
C
TCCCCAACACCTGAAGAGCCCATTTAA


Translation (545 aa):
MALPSPASEEAEGPCQEANQEYQEPVCSPVPEPEPEPEPEPEPDPEPVPVPPPEPQPEPEPQPLPDPAPL
P
ELGFEAEPVQEPEPTPTVETRGTARGFQPPEGGFGWIVVFAATWCNGSIFGIHNSVGILYSMLLEEEKE
K
NRQVEFQA
AWVGALAMGMIFFCSPIVSIFTDRLGCRITATTGAAVAFIGLHTSSFTSSLSLRYFTYGIL
F
GCGCSFAFQPSLVILGHYFQRRLGLANGVVSAGSSIFSMSFPFLIKMLGDKIKLAQTFQVLSTFMFVLT
L
LSLTYRPLLPSSQDTPSKRGAHTLRQRFLVQFRKYFNMRVFRQRTYRIWAFGIAAAALGYFVPYVHL
MK
Y
VEDKFKEIKETWVLLVCIGATSGLGRLVSGHISDSIPGLKKIYLQ
VLSFLLLGLMSMMIPLCRDFGGLI
V
VCLFLGLCDGFFITIMAPIAFELVGPMQASQAIGYLLGMMALPMIAGPPIA
GLLRNCFGDYHVAFYFAG
V
PPIIGAVILFFVPLMHQRMFKKEQRDSSKDKMLSHDPDPNGELLPGSPTPEEPI




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser