NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS39054.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
39054.1 Public Mus musculus 5 Ift172 21 106 86 CCDS HistoryNCBI Gene:67661Re-query CCDS DB by CCDS ID:39054.1Re-query CCDS DB by GeneID:67661See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 39054.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000041565 ENSMUSP00000049335 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000041565Link to Ensembl Protein Viewer:ENSMUSP00000049335Re-query CCDS DB by Nucleotide ID:ENSMUST00000041565Re-query CCDS DB by Protein ID:ENSMUSP00000049335
Original member Current member EBI,WTSI OTTMUST00000136725 OTTMUSP00000072125 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000136725Link to Vega Protein Viewer:OTTMUSP00000072125Re-query CCDS DB by Nucleotide ID:OTTMUST00000136725Re-query CCDS DB by Protein ID:OTTMUSP00000072125
Original member Current member NCBI NM_026298.5 NP_080574.5 Accepted alive Link to Nucleotide Sequence:NM_026298.5Link to Protein Sequence:NP_080574.5Re-query CCDS DB by Nucleotide ID:NM_026298Re-query CCDS DB by Protein ID:NP_080574Link to BLAST:NP_080574.5

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_080574.5 1749 Q6VH22-1 1749 100% 0 0

Chromosomal Locations for CCDS 39054.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 5Link to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 31253335 31253424 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 31253553 31253644 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 31253815 31253968 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 31254219 31254317 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 31254402 31254461 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 31254653 31254748 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 31255251 31255370 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 31255565 31255675 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 31256555 31256671 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 31256889 31256975 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 31257331 31257394 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 31257517 31257626 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 31257814 31257912 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 31260394 31260523 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 31260623 31260732 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 31260927 31261107 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 31261439 31261503 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 31261831 31261924 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 31262920 31263062 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 31263366 31263482 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 31263571 31263706 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 31263778 31263875 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 31264407 31264496 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 31265318 31265462 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 31265643 31265763 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 31265915 31265993 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 31266175 31266423 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 31266635 31266712 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 31267234 31267326 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 31267595 31267679 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 31271640 31271747 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 31271987 31272123 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 31275852 31276019 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 31276869 31276981 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 31280419 31280504 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 31280666 31280769 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 31280962 31281015 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 31281344 31281505 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 31282556 31282651 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 31283033 31283156 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 31284004 31284218 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 31285252 31285339 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 31285459 31285538 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 31285763 31285828 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 31286078 31286117 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 31286577 31286689 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 31286894 31287037 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 31290974 31291012 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (5250 nt):
ATGCAGTTGAAGCACCTGAGGACCCTGCTGAGCCCTCAGGATGGAGCTGCGAAGGTGACATGCATGGCCT
GG
TCCCAGAACAATGCTAAATTTGCTGTCTGCACAGTGGACCGAGTGGTACTTCTGTATGATGAACATGG
G
GAGCGGAGAGACAAGTTCTCCACCAAACCAGCTGACATGAAGTACGGCAGGAAAAGCTACATGGTGAAA
GGC
ATGGCTTTCTCTCCCGATTCCACAAAAATTGCCATAGGACAGACTGACAACATCATCTATGTCTACA
AG
ATTGGAGAAGATTGGGGAGACAAGAAGGTCATCTGCAACAAGTTCATCCAGACGAGTGCTGTGACTTG
T
CTGCAGTGGCCTGCGGAATACGTCATTGTCTTTGGACTGGCAGAAGGCAAGGTTCGCTTAGCAAACACT
AAA
ACTAACAAGTCATCTACTATCTATGGGACAGAGTCTTACGTGGTAGCACTGACAACCAACTGCTCTG
GG
AAGGGGATCCTCTCGGGTCACGCAGACGGCACCATCGTCAGGTACTTCTTCGATGATGAAGGCTCTGG
A
GAGTCACAGGGAAAGTTGGTTAACCATCCATGCCCACCCTATGCCTTGGCCTGGGCCACCAACAGCATT
GTG
GCCGCTGGCTGTGACCGGAGGATTGTGGCCTATGGAAAGGAAGGCCATGTGCTGCAGACTTTTGACT
AT
AGCCGAGACCCTCAGGAGCGGGAGTTCACCACAGCTGCTGCAAGTCCTGGAGGCCAGTCTGTTGTGCT
G
GGAAGTTATGACAGACTTCGGGTGTTCAACTGGAGTCCTCGAAGAAGCATCTGGGAAGAGGCGAAACCC
AAG
GAGATCGCTAACTTATACACCGTCACCGCCCTGGCCTGGAAGCGGGATGGCTCACGACTCTGTGCGG
GA
ACACTCTGTGGTGGGGTGGAACAGTTTGACTGCTGCCTCCGAAGGAGCATTTACAAGAACAAGTTCGA
G
CTGACGTATGTGGGCCCTAGCCAGGTGATTGTGAAGAACCTGTCTTCAGGGACCAGGGTGGTGCTCAAG
TCA
CACTATGGCTATGAAGTAGAAGAGGTGAAAATCCTGGGAAAGGAACGTTACTTGGTGGCTCACACAT
CA
GACACACTGCTGCTGGGAGACCTGAACACGAACCGCCTCAGCGAGATAGCCTGGCAGGGATCTGGGGG
C
AATGAGAAATATTTCTTTGAAAATGAGAATGTGTGCATGATCTTCAATGCTGGAGAGCTGACCCTGGTG
GAA
TATGGGAGTAACGACTCCTTGGGTTCTGTGCGCACCGAATTCATGAACCCTCACCTCATCAGCGTCC
GT
ATCAATGAGCGCTGCCAGCGAGGAATGGAAGATAATAAGAAATTGGCTTATCTTGTTGATATTAAGAC
A
ATTGCTATAGTGGATCTGATTGGTGGCTACAACATTGGTACTATCAGTCACGAAAGCCGGGTGGATTGG
CTA
GAACTTAACGAGACTGGACACAAGCTTCTCTTTAGAGACCGGAAACTTCGGCTGCATCTATATGATA
TT
GAAAGCTGCTCTAAGACAATGATCCTCAACTTCTGCTCCTACGTGCAGTGGGTTCCGGGGAGTGATGT
G
CTGGTAGCTCAGAACCGAAACAGCTTATGTGTATGGTACAATATTGAGGCCCCTGAGAGAGTCACCATG
TCC
TCTATCAGGGGTGATGTTGTCGGTCTGGAGCGAGGTGGTGGGAAGACAGAGGTCATGGTGACAGAAG
GC
GTGACTACTGTGGCCTACACCCTGGACGAGGGCCTGATTGAGTTTGGAACAGCCATCGATGATGGCAA
C
TACACCCGGGCTACAGCCTTCTTGGAGACCCTGGAGATGACTCCCGAAACAGAGGCAATGTGGAAAACC
TTG
AGCAAACTGGCCCTGGAGGCAAGGCAGCTTCACACTGCTGAGAGGTGCTTCTCTGCTTTAGGTCATG
TG
GCCAAAGCTCGGTTCCTGCATGAGACCAATGAGATTGCAGATCAGGTGTCCAGGGAATATGGTGGAGA
A
GGAACGGACTTCTATCAGGTCCGAGCTCGTCTCGCCATGCTGGAGAAGAACTACAAACTTGCTGAGATG
ATC
TTCTTGGAACAGAATGCTGTTGAGGAGGCCATGGACATGTACCAAGAGTTGCACCGCTGGGAGGAAT
GC
ATTGCTGTGGCTGAGGCCAAGGGACACCCAGCCCTGGAGAAGCTGCGCAGAGACTACTATCAATGGTT
A
ATGGACACACAGCAAGAGGAACGAGCAGGTGAACTGCAGGAGAGCCAAGGGGATGGGCTGGCAGCTATC
AGC
CTCTACCTCAAAGCTGGGCTCCCTGCCAAAGCTGCGCGGCTGGTGCTGACCCGAGAGGAGCTGCTGG
CC
AACACAGAACTAGTAGAACATATCACCACAGCCCTCATCAAGGGAGAGCTCTATGAAAGGGCAGGTGA
T
CTCTTTGAGAAGATTCGAAATCCACAGCGGGCCCTTGAGTGTTACTGTAAAGGCAATGCATTCATGAAA
G
CT
GTTGAGCTGGCTCGACTGGCCTTCCCAGTGGAGGTGGTGAGGCTAGAGGAGGCCTGGGGGGACCACT
TG
GTACAGCAAAAGCAGCTGGATGCGGCCATCAACCACTATATTGAAGCCAGGTGCTCCATCAAAGCAAT
T
GAGGCTGCCCTGGGTGCCCGCCAGTGGAAGAAGGCAATTTATATATTAGATCTCCAGGATCGCAACACT
GCA
TCTAAATACTATCCTCGTGTGGCTCAACACTATGCGTCTCTGCAGGAGTATGAGATTGCTGAGGAGC
TC
TACACCAAAGGAGACCGGACCAAAGACGCCATAGACATGTACACCCAGGCCGGCCGCTGGGAGCAAGC
C
CACAAGCTGGCCATGAAATGCATGCGACCCGAGGACGTGTCCGTGCTTTACATCACACAAGCCCAGGAG
ATG
GAGAAGCAGGGCAAGTACCGAGAGGCTGAGAGGCTGTACGTGACGGTGGAGGAGCCTGATCTCGCCA
TC
ACCATGTTCAAAAAGCACAAGTTGTATGACGACATGATTCGCCTGGTGGGGAAGCACCATCCAGACCT
C
CTCAGCGACACACACCTTCACCTGGGCAAGGAGCTGGAGGCAGAAGGCCGACTGCAGGAGGCTGAGTAT
CAC
TACCTTGAGGCCCAGGAATGGAAGGCAACTGTGAACATGTACCGCTCCAGCGGGCTTTGGGAGGAGG
CC
TACCGGGTGGCCAAAGCCCATGGAGGAGCCAATGCCCACAAACACGTGGCCTATCTGTGGGCCAAAAG
C
CTGGGAGGAGAGGCTGCAGTTAGACTACTTAACAAGCTGGGACTTCTGGAGGCCACCATTGACCATGCT
GCT
GACAACTGCTCCTTTGAGTTTGCCTTTGAACTCTCTCGGCTAGCCTTCAAGCACAAAGCCCCAGAGA
TT
CATCTCAAATACGCCATGTACCTGGAAGATGAGGGCAAATTTGAAGAGGCTGAAGCTGAATTCATCCG
A
GCTGGTAAACCCAAAGAGGCGGTCCTCATGTTTGTCCACAACCAGGACTGGGAGGCAGCTCAGCGCGTG
GCT
GAGGCCCACGATCCTGACAGCGTTGCTGAGGTACTTGTAGGTCAAGCCCGTGGGGCCTTGGAGGAGA
AG
GACTTTCAGAAGGCAGAAGGGTTACTACTTCGGGCCCAGAGACCAGGTCTGGCTCTCAATTATTATAA
G
GAGGCTGGACTCTGGAGCGACGCTCTGAGAATCTGCAAGGACTATGTGCCTGGCCAGCTAGAGGCCCTA
CAG
GAAGAGTATGAGCGAGAAGCTACCAAGAAGGGAGGCAGAGGGGTGGAGGGACTTGTAGAGCAAGCAC
GG
CAGTGGGAACAGGCTGGAGAGTATAGCCGTGCAGTGGACTGCTACCTCAAAGTTCGCGACTCAGGAAG
C
AGTGGCCTGATGGAGAAGTGCTGGATGAAGGCGGCTGAACTGTCCATCAAGTTCCTGCCTCCCCAGCGC
AGT
CTGGAAGTCGTCCGGGTTGTAGGGCCCCAGCTGATCGGGATTGGAAAGCACAGTGCTGCTGCAGAAC
TC
TATCTGAACCTGGACCTTGTCAAAGAAGCAATCGATGCTTTCATTGAGGGGGAAGAGTGGAACAAGGC
C
AAGCGCGTGGCCAAAGAGCTAGATCCCCGGTATGAGGACTATGTGGATCAGCACTATAAGGAGTTCCTC
AAG
AACCAGGGCAAAGTGGATTCGCTGGTGGGTGTGGACGTAGTAGCTGCCTTGGACCTGTATGTGGAGC
AG
GGCCAGTGGGATAAATGCATTGAAACAGCTACCAAGCAGAACTACAAGATTCTGCACAAGTATGTGGC
T
TTGTATGCAACTCATCTGATCCGAGAAGGTGGCTATGCCCAGGCACTGGCCCTCTATGTGCAACACGGA
GCC
CCTGCAAACCCACAGAATTTCAACATCTACAAAAGGATCTTCACTGACATGGTTAGCTCTCCTGGGA
CC
AACAATGCTGAGGCCTACCATAGCTGGGCTGATCTTCGGGATGTCCTCTTCAACCTGTGTGAAAACCT
G
GTGAAGTCCAGTGAGGCAAACTCTGCAGCGCATGAGGAGTTTGAGATGATGCTGCTGATCTCTCATTAC
TAC
GCTACGCGATCTGCAGCCCAGAGTATCAAACAGCTGGAAACCGTAGCTGCCAGGCTTTCTGTTTCGC
TC
TTGCGCCACACCCAGTTACTCCCTGCAGACAAGGCCTTTTATGAAGCGGGCACTGCTGCCAAGGAAGT
T
GGCTGGGAGAACATGGCTTTCATTTTCCTCAATCGGTTCTTGGATCTGACTGATGCAATCGAAGAAGGG
ACC
CTGGATGCCCTGGACCATTCAGATTTTCAGGATACTGACATTCCCTTTGAGGTGCCGCTCCCAGCCA
AG
CAGCACGTCCCGGAGGCCCAGAGAGAAGAGGTCCGAGACTGGGTGCTCACAGTCTCGATGGACCAGAG
A
CTGGAGCAGGTTCTGCCCCGGGATGAGCGAGGTGTCTATGAGGCTTCCCTAGTTGCCGCGAGCACTGGA
GTT
CGGGCACTGCCCTGCCTCATCACAGGTTACCCCATTTTGAGGAACAAAATTGAATTTAAGCGGCCTG
GG
AAGGCTGCTAACAAAGACAACTGGAACAAGTTTCTTATGGCCATCAAGACCTCTCACAGCCCAGTGTG
C
CAGGACGTGCTCAAGTTCATCAGCCAGTGGTGCGGTGGTCTCCCTAGCACCAGCTTTTCCTTTCAGTGA


Translation (1749 aa):
MQLKHLRTLLSPQDGAAKVTCMAWSQNNAKFAVCTVDRVVLLYDEHGERRDKFSTKPADMKYGRKSYMVK
G
MAFSPDSTKIAIGQTDNIIYVYKIGED
WGDKKVICNKFIQTSAVTCLQWPAEYVIVFGLAEGKVRLANT
K
TNKSSTIYGTESYVVALTT
NCSGKGILSGHADGTIVRYFFDDEGSGESQGKLVNHPCPPYALAWATNSI
V
AAGCDRRIVAYGKEGHVLQTFDYSRDPQEREFTTAAASPGGQSVVLGSYD
RLRVFNWSPRRSIWEEAKP
K
EIANLYTVTALAWKRDGSRLCA
GTLCGGVEQFDCCLRRSIYKNKFELTYVGPSQVIVKNLSSGTRVVLK
S
HYGYEVEEVKILGKERYLVAHTSDTLLLGDLNTNRLSE
IAWQGSGGNEKYFFENENVCMIFNAGELTLV
E
YGSNDSLGSVRTEFMNPHLI
SVRINERCQRGMEDNKKLAYLVDIKTIAIVDLIGGYNIGTISHESRVDW
L
ELNETGHKLLFRDRKLR
LHLYDIESCSKTMILNFCSYVQWVPGSDVLVAQNRNSLCVWYNIEAPERVTM
S
SIR
GDVVGLERGGGKTEVMVTEGVTTVAYTLDEGLIEFGTAIDDGNYTRATAFLETLEMTPETEAMWKT
L
SKLALEARQLHTAE
RCFSALGHVAKARFLHETNEIADQVSREYGGEGTDFYQVRARLAMLEKNYKLAEM
I
FLEQ
NAVEEAMDMYQELHRWEECIAVAEAKGHPALEKLRRDYYQWLMDTQQEERAGELQESQGDGLAAI
S
LYLKAGLPAKAARLVLTREELLANTELVEHITTALIKGELYER
AGDLFEKIRNPQRALECYCKGNAFMK
A
VELARLAFPVEVVRLEEAWGDHLVQQKQLDAAINHYIEARCSIKAIEAALGARQWKKAIYILDLQDRNT
A
SKYYPRVAQHYASLQEYE
IAEELYTKGDRTKDAIDMYTQAGRWEQAHKLAMKCMRPEDVSVLYITQAQE
M
EKQGKYREAE
RLYVTVEEPDLAITMFKKHKLYDDMIRLVGKHHPDLLSDTHLHLGKELEAEGRLQEAEY
H
YLEAQEWKATVNMYRSSGLWEEAYR
VAKAHGGANAHKHVAYLWAKSLGGEAAVRLLNKLGLLEATIDHA
A
DN
CSFEFAFELSRLAFKHKAPEIHLKYAMYLEDEGKFEEAEAEFIRAGKPKEAVLMFVHNQDWEAAQRV
A
EAHDPDSVAEVLVGQARGALEEKDFQKAEGLLLRAQRPGLALNYYK
EAGLWSDALRICKDYVPGQLEAL
Q
EEYEREATKKGG
RGVEGLVEQARQWEQAGEYSRAVDCYLKVRDSGSSGLMEKCWMKAAELSIKFLPPQR
S
LEVVRVVGPQLIGIGKHSA
AAELYLNLDLVKEAIDAFIEGEEWNKAKRVAKELDPRYEDYVDQHYKEFL
K
NQGKVDS
LVGVDVVAALDLYVEQGQWDKCIETATKQNYKILHKYVALYATHLIREGGYAQALALYVQHG
A
PANPQ
NFNIYKRIFTDMVSSPGTNNAEAYHSWADLRDVLFNLCENLVKSSEANSAAHEEFEMMLLISHY
Y
ATRSAAQSIKQL
ETVAARLSVSLLRHTQLLPADKAFYEAGTAAKEVGWENMAFIFLNRFLDLTDAIEEG
T
LDALDHSDFQDTDIPFEVPLPAKQHVP
EAQREEVRDWVLTVSMDQRLEQVLPRDERGVYEASLVAASTG
V
RALPCLIT
GYPILRNKIEFKRPGKAANKDNWNKFLMAIKTSHSPVCQDVLKFISQWCGGLPSTSFSFQ



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser