NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS35644.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
35644.1 Public Mus musculus 1 Htr2b 21 106 86 CCDS HistoryNCBI Gene:15559Re-query CCDS DB by CCDS ID:35644.1Re-query CCDS DB by GeneID:15559See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 35644.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000027431 ENSMUSP00000027431 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000027431Link to Ensembl Protein Viewer:ENSMUSP00000027431Re-query CCDS DB by Nucleotide ID:ENSMUST00000027431Re-query CCDS DB by Protein ID:ENSMUSP00000027431
Original member Current member EBI,WTSI OTTMUST00000085661 OTTMUSP00000046300 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000085661Link to Vega Protein Viewer:OTTMUSP00000046300Re-query CCDS DB by Nucleotide ID:OTTMUST00000085661Re-query CCDS DB by Protein ID:OTTMUSP00000046300
Original member Current member NCBI NM_008311.2 NP_032337.2 Accepted alive Link to Nucleotide Sequence:NM_008311.2Link to Protein Sequence:NP_032337.2Re-query CCDS DB by Nucleotide ID:NM_008311Re-query CCDS DB by Protein ID:NP_032337Link to BLink:NP_032337.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_032337.2 479 Q02152 479 100% 0 0

Chromosomal Locations for CCDS 35644.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 1Link to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 86099343 86100232 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 86102422 86102622 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 86110534 86110882 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1440 nt):
ATGGCTTCATCTTATAAAATGTCTGAACAAAGCACAACTTCTGAGCACATTTTACAGAAGACATGTGATC
AC
CTGATCCTGACTAACCGTTCTGGATTAGAGACAGACTCAGTAGCAGAGGAAATGAAGCAGACTGTGGA
G
GGACAGGGGCATACAGTGCACTGGGCAGCTCTCCTGATACTCGCGGTGATAATACCCACCATTGGTGGG
AAC
ATCCTTGTGATTCTGGCTGTTGCACTGGAGAAAAGGCTGCAGTACGCTACCAACTACTTTTTAATGT
CC
TTGGCGATAGCAGATTTGCTGGTTGGATTGTTTGTGATGCCGATTGCCCTCTTGACAATCATGTTTGA
G
GCTATATGGCCCCTCCCACTGGCCCTGTGTCCTGCCTGGTTATTCCTCGATGTTCTCTTTTCAACTGCC
TCC
ATCATGCATCTCTGTGCCATTTCCCTGGACCGCTATATAGCCATCAAAAAGCCAATTCAGGCCAATC
AG
TGCAACTCCCGGGCTACTGCATTCATCAAGATTACAGTGGTATGGTTAATTTCAATAGGCATCGCCAT
C
CCAGTCCCTATTAAAGGAATCGAGACTGATGTGATTAATCCACACAATGTCACCTGTGAGCTGACAAAG
GAC
CGCTTTGGCAGTTTTATGGTCTTTGGGTCACTGGCTGCTTTCTTCGCACCTCTCACCATCATGGTAG
TC
ACTTACTTTCTCACCATTCACACTTTACAGAAGAAAGCTTACTTGGTCAAAAATAAGCCACCTCAACG
C
CTAACACGGTGGACTGTGCCCACAGTTTTCCTAAGGGAAGACTCATCCTTTTCATCACCAGAAAAGGTG
GCA
ATGCTGGATGGGTCTCACAGGGATAAAATTCTACCTAACTCAAGTGATGAGACACTTATGCGAAGAA
TG
TCCTCAGTTGGAAAAAGATCAGCCCAAACCATTTCTAATGAGCAGAGAGCCTCGAAGGCCCTTGGAGT
C
GTGTTTTTCCTTTTTCTGCTTATGTGGTGCCCCTTTTTTATTACAAATCTAACTTTAGCTCTGTGTGAT
TCC
TGCAATCAGACCACTCTCAAAACACTCCTGGAGATATTTGTGTGGATAGGCTACGTTTCCTCGGGGG
TG
AATCCTCTGATCTATACACTCTTCAATAAGACATTTCGGGAAGCATTTGGCAGGTACATCACCTGCAA
T
TACCGAGCCACAAAGTCAGTAAAAGCACTTAGGAAGTTTTCCAGTACACTTTGTTTTGGGAATTCAATG
GTA
GAAAACTCTAAATTTTTCACAAAACATGGAATTCGAAATGGGATCAACCCTGCCATGTACCAGAGCC
CA
ATGAGGCTCCGAAGTTCAACCATTCAGTCCTCATCAATCATCCTCCTCGATACCCTTCTCACTGAAAA
C
GATGGCGACAAAGCGGAAGAGCAGGTCAGCTACATATAG


Translation (479 aa):
MASSYKMSEQSTTSEHILQKTCDHLILTNRSGLETDSVAEEMKQTVEGQGHTVHWAALLILAVIIPTIGG
N
ILVILAVALEKRLQYATNYFLMSLAIADLLVGLFVMPIALLTIMF
EAIWPLPLALCPAWLFLDVLFSTA
S
IMHLCAISLDRYIAIKKPIQANQCNSRATAFIKITVVWLISI
GIAIPVPIKGIETDVINPHNVTCELTK
D
RFGSFMVFGSLAAFFAPLTIMVVTYFLTIHTLQKKAYLVKNKPPQRLTRWTVPTVFLREDSSFSSPEKV
A
MLDGSHRDKILPNSSDETLMRRMSSVGKRSAQTISNEQRASKALGVVFFLFLLMWCPFFITNLTLALCD
S
CNQTTLKTLLEIFVWIGYVSSGVNPLIYTLFNKTFREAFGRYITCNYRATKSVKALRKFSSTLCFGNSM
V
ENSKFFTKHGIRNGINPAMYQSPMRLRSSTIQSSSIILLDTLLTENDGDKAEEQVSYI




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser