NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS29872.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
29872.1 Public Mus musculus 19 Pitx3 21 106 86 CCDS HistoryNCBI Gene:18742Re-query CCDS DB by CCDS ID:29872.1Re-query CCDS DB by GeneID:18742See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 29872.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000026259 ENSMUSP00000026259 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000026259Link to Ensembl Protein Viewer:ENSMUSP00000026259Re-query CCDS DB by Nucleotide ID:ENSMUST00000026259Re-query CCDS DB by Protein ID:ENSMUSP00000026259
Original member Current member EBI,WTSI OTTMUST00000050294 OTTMUSP00000023460 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000050294Link to Vega Protein Viewer:OTTMUSP00000023460Re-query CCDS DB by Nucleotide ID:OTTMUST00000050294Re-query CCDS DB by Protein ID:OTTMUSP00000023460
Original member Current member NCBI NM_008852.4 NP_032878.1 Accepted alive Link to Nucleotide Sequence:NM_008852.4Link to Protein Sequence:NP_032878.1Re-query CCDS DB by Nucleotide ID:NM_008852Re-query CCDS DB by Protein ID:NP_032878Link to BLink:NP_032878.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_032878.1 302 O35160 302 100% 0 0

Chromosomal Locations for CCDS 29872.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 19 (NC_000085.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 19Link to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 46136018 46136605 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 46136983 46137185 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 46137365 46137482 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (909 nt):
ATGGAGTTTGGGCTGCTTGGTGAGGCAGAGGCGCGAAGCCCTGCGCTGTCGTTATCGGACGCAGGCACTC
CA
CACCCTCCGCTTCCAGAACATGGCTGCAAGGGGCAGGAGCACAGTGACTCGGAGAAGGCCTCGGCCTC
A
CTGCCGGGGGGCTCCCCCGAGGACGGCTCTCTGAAGAAGAAGCAGCGGCGGCAGCGCACGCACTTCACC
AGC
CAGCAGCTGCAGGAGCTGGAGGCCACCTTCCAGAGGAATCGCTACCCTGACATGAGCACCCGCGAAG
AG
ATCGCGGTGTGGACCAACCTCACTGAGGCCCGCGTGCGGGTGTGGTTCAAGAACCGGCGCGCCAAGTG
G
CGGAAGCGGGAGCGCAGCCAGCAGGCGGAGCTGTGCAAAGGTGGCTTCGCAGCCCCGCTCGGGGGCCTG
GTG
CCACCCTACGAGGAGGTGTACCCGGGCTACTCGTACGGCAACTGGCCGCCCAAGGCTCTCGCCCCGC
CG
CTCGCCGCCAAGACCTTCCCGTTCGCCTTCAACTCGGTCAACGTGGGGCCTCTGGCTTCACAGCCTGT
A
TTCTCACCGCCCAGCTCCATCGCCGCTTCTATGGTGCCCTCGGCCGCCGCTGCCCCGGGCACCGTACCA
GGT
CCCGGAGCCTTGCAGGGCCTGGGCGGGGCACCCCCCGGGCTGGCTCCAGCCGCCGTGTCCTCCGGGG
CA
GTGTCCTGCCCTTACGCCTCGGCCGCCGCAGCCGCCGCTGCAGCCGCCTCCTCCCCCTATGTATACCG
G
GACCCGTGTAACTCGAGCCTGGCTAGCCTGCGGCTCAAAGCCAAGCAGCACGCCTCTTTCAGCTATCCC
GCC
GTGCCCGGGCCGCCGCCGGCCGCTAACCTTAGCCCCTGCCAGTACGCCGTGGAACGGCCGGTGTGA


Translation (302 aa):
MEFGLLGEAEARSPALSLSDAGTPHPPLPEHGCKGQEHSDSEKASASLPGGSPEDGSLKKKQRRQRTHFT
S
QQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVR
VWFKNRRAKWRKRERSQQAELCKGGFAAPLGGL
V
PPYEEVYPGYSYGNWPPKALAPPLAAKTFPFAFNSVNVGPLASQPVFSPPSSIAASMVPSAAAAPGTVP
G
PGALQGLGGAPPGLAPAAVSSGAVSCPYASAAAAAAAAASSPYVYRDPCNSSLASLRLKAKQHASFSYP
A
VPGPPPAANLSPCQYAVERPV




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser