NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS37881.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
37881.1 Public Mus musculus 19 Lrp5 21 106 86 CCDS HistoryNCBI Gene:16973Re-query CCDS DB by CCDS ID:37881.1Re-query CCDS DB by GeneID:16973See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 37881.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000025856 ENSMUSP00000025856 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000025856Link to Ensembl Protein Viewer:ENSMUSP00000025856Re-query CCDS DB by Nucleotide ID:ENSMUST00000025856Re-query CCDS DB by Protein ID:ENSMUSP00000025856
Original member Current member EBI,WTSI OTTMUST00000110769 OTTMUSP00000061850 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000110769Link to Vega Protein Viewer:OTTMUSP00000061850Re-query CCDS DB by Nucleotide ID:OTTMUST00000110769Re-query CCDS DB by Protein ID:OTTMUSP00000061850
Original member Current member NCBI NM_008513.3 NP_032539.2 Accepted alive Link to Nucleotide Sequence:NM_008513.3Link to Protein Sequence:NP_032539.2Re-query CCDS DB by Nucleotide ID:NM_008513Re-query CCDS DB by Protein ID:NP_032539Link to BLAST:NP_032539.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_032539.2 1614 Q91VN0-1 1614 100% 0 0

Chromosomal Locations for CCDS 37881.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 19 (NC_000085.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 19Link to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 3585030 3585291 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 3586383 3586480 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 3590974 3591113 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 3591616 3591852 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 3593516 3593626 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 3597244 3597480 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 3600673 3600798 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 3602235 3602444 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 3604002 3604192 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 3605286 3605494 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 3610039 3610238 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 3612198 3612521 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 3614226 3614410 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 3615653 3615879 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 3620015 3620304 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 3622510 3622726 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 3628273 3628444 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 3630074 3630470 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 3647528 3647659 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 3649404 3649600 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 3652133 3652330 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 3659244 3659640 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 3686355 3686442 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (4845 nt):
ATGGAAACGGCGCCGACCCGGGCCCCTCCGCCGCCGCCGCCGCCGCTGCTGCTGCTGGTGCTGTACTGCA
GC
TTGGTCCCCGCCGCGGCCTCACCGCTCCTGTTGTTTGCCAACCGCCGGGATGTGCGGCTAGTGGATGC
C
GGCGGAGTGAAGCTGGAGTCCACCATTGTGGCCAGTGGCCTGGAGGATGCAGCTGCTGTAGACTTCCAG
TTC
TCCAAGGGTGCTGTGTACTGGACAGATGTGAGCGAGGAGGCCATCAAACAGACCTACCTGAACCAGA
CT
GGAGCTGCTGCACAGAACATTGTCATCTCGGGCCTCGTGTCACCTGATGGCCTGGCCTGTGACTGGGT
T
GGCAAGAAGCTGTACTGGACGGACTCCGAGACCAACCGCATTGAGGTTGCCAACCTCAATGGGACGTCC
CGT
AAGGTTCTCTTCTGGCAGGACCTGGACCAGCCAAGGGCCATTGCCCTGGATCCTGCACATGGGTACA
TG
TACTGGACTGACTGGGGGGAAGCACCCCGGATCGAGCGGGCAGGGATGGATGGCAGTACCCGGAAGAT
C
ATTGTAGACTCCGACATTTACTGGCCCAATGGGCTGACCATCGACCTGGAGGAACAGAAGCTGTACTGG
GCC
GATGCCAAGCTCAGCTTCATCCACCGTGCCAACCTGGACGGCTCCTTCCGGCAGAAGGTGGTGGAGG
GC
AGCCTCACTCACCCTTTTGCCCTGACACTCTCTGGGGACACACTCTACTGGACAGACTGGCAGACCCG
C
TCCATCCACGCCTGCAACAAGTGGACAGGGGAGCAGAGGAAGGAGATCCTTAGTGCTCTGTACTCACCC
ATG
GACATCCAAGTGCTGAGCCAGGAGCGGCAGCCTCCCTTCCACACACCATGCGAGGAGGACAACGGTG
GC
TGTTCCCACCTGTGCCTGCTGTCCCCGAGGGAGCCTTTCTACTCCTGTGCCTGCCCCACTGGTGTGCA
G
TTGCAGGACAATGGCAAGACGTGCAAGACAGGGGCTGAGGAAGTGCTGCTGCTGGCTCGGAGGACAGAC
CTG
AGGAGGATCTCTCTGGACACCCCTGACTTCACAGACATAGTGCTGCAGGTGGGCGACATCCGGCATG
CC
ATTGCCATTGACTACGATCCCCTGGAGGGCTACGTGTACTGGACCGACGATGAGGTGCGGGCTATCCG
C
AGGGCGTACCTAGATGGCTCAGGTGCGCAGACACTTGTGAACACTGAGATCAATGACCCCGATGGCATT
GCT
GTGGACTGGGTCGCCCGGAACCTCTACTGGACAGATACAGGCACTGACAGAATTGAGGTGACTCGCC
TC
AACGGCACCTCCCGAAAGATCCTGGTATCTGAGGACCTGGACGAACCGCGAGCCATTGTGTTGCACCC
T
GTGATGGGCCTCATGTACTGGACAGACTGGGGGGAGAACCCCAAAATCGAATGCGCCAACCTAGATGGG
AGA
GATCGGCATGTCCTGGTGAACACCTCCCTTGGGTGGCCCAACGGACTGGCCCTGGACCTGCAGGAGG
GC
AAGCTGTACTGGGGGGATGCCAAAACTGATAAAATCGAGGTGATCAACATAGATGGGACAAAGCGGAA
G
ACCCTGCTTGAGGACAAGCTCCCACATATTTTTGGGTTCACACTGCTGGGGGACTTCATCTACTGGACC
GAC
TGGCAGAGACGCAGTATTGAAAGGGTCCACAAGGTCAAGGCCAGCCGGGATGTCATCATTGATCAAC
TC
CCCGACCTGATGGGACTCAAAGCTGTGAATGTGGCCAAGGTTGTCGGAACCAACCCATGTGCGGATGG
A
AATGGAGGGTGCAGCCATCTGTGCTTCTTCACCCCACGTGCCACCAAGTGTGGCTGCCCCATTGGCCTG
GAG
CTGTTGAGTGACATGAAGACCTGCATAATCCCCGAGGCCTTCCTGGTATTCACCAGCAGAGCCACCA
TC
CACAGGATCTCCCTGGAGACTAACAACAACGATGTGGCTATCCCACTCACGGGTGTCAAAGAGGCCTC
T
GCACTGGACTTTGATGTGTCCAACAATCACATCTACTGGACTGATGTCAGCCTCAAGACGATCAGCCGA
GCC
TTCATGAATGGGAGCTCAGTGGAGCACGTGATTGAGTTTGGCCTCGACTACCCTGAAGGAATGGCTG
TG
GACTGGATGGGCAAGAACCTCTATTGGGCGGACACAGGGACCAACAGGATTGAGGTGGCCCGGCTGGA
T
GGGCAGTTCCGGCAGGTGCTTGTGTGGAGAGACCTTGACAACCCCAGGTCTCTGGCTCTGGATCCTACT
AAA
GGCTACATCTACTGGACTGAGTGGGGTGGCAAGCCAAGGATTGTGCGGGCCTTCATGGATGGGACCA
AT
TGTATGACACTGGTAGACAAGGTGGGCCGGGCCAACGACCTCACCATTGATTATGCCGACCAGCGACT
G
TACTGGACTGACCTGGACACCAACATGATTGAGTCTTCCAACATGCTGGGTCAGGAGCGCATGGTGATA
GCT
GACGATCTGCCCTACCCGTTTGGCCTGACTCAATATAGCGATTACATCTACTGGACTGACTGGAACC
TG
CATAGCATTGAACGGGCGGACAAGACCAGTGGGCGGAACCGCACCCTCATCCAGGGTCACCTGGACTT
C
GTCATGGACATCCTGGTGTTCCACTCCTCCCGTCAGGATGGCCTCAACGACTGCGTGCACAGCAATGGC
CAG
TGTGGGCAGCTGTGCCTCGCCATCCCCGGAGGCCACCGCTGTGGCTGTGCTTCACACTACACGCTGG
AC
CCCAGCAGCCGCAACTGCAGCCCGCCCTCCACCTTCTTGCTGTTCAGCCAGAAATTTGCCATCAGCCG
G
ATGATCCCCGATGACCAGCTCAGCCCGGACCTTGTCCTACCCCTTCATGGGCTGAGGAACGTCAAAGCC
ATC
AACTATGACCCGCTGGACAAGTTCATCTACTGGGTGGACGGGCGCCAGAACATCAAGAGGGCCAAGG
AC
GACGGTACCCAGCCCTCCATGCTGACCTCTCCCAGCCAAAGCCTGAGCCCAGACAGACAGCCACACGA
C
CTCAGCATTGACATCTACAGCCGGACACTGTTCTGGACCTGTGAGGCCACCAACACTATCAATGTCCAC
CGG
CTGGATGGGGATGCCATGGGAGTGGTGCTTCGAGGGGACCGTGACAAGCCAAGGGCCATTGCTGTCA
AT
GCTGAGCGAGGGTACATGTACTTTACCAACATGCAGGACCATGCTGCCAAGATCGAGCGAGCCTCCCT
G
GATGGCACAGAGCGGGAGGTCCTCTTCACCACAGGCCTCATCCGTCCCGTGGCCCTTGTGGTGGACAAT
GCT
CTGGGCAAGCTCTTCTGGGTGGATGCCGACCTAAAGCGAATCGAAAGCTGTGACCTCTCTGGGGCCA
AC
CGCCTGACCCTGGAAGATGCCAACATCGTACAGCCAGTAGGTCTGACAGTGCTGGGCAGGCACCTCTA
C
TGGATCGACCGCCAGCAGCAGATGATCGAGCGCGTGGAGAAGACCACTGGGGACAAGCGGACTAGGGTT
CAG
GGCCGTGTCACCCACCTGACAGGCATCCATGCCGTGGAGGAAGTCAGCCTGGAGGAGTTCTCAGCCC
AT
CCTTGTGCCCGAGACAATGGCGGCTGCTCCCACATCTGTATCGCCAAGGGTGATGGAACACCGCGCTG
C
TCGTGCCCTGTCCACCTGGTGCTCCTGCAGAACCTGCTGACTTGTGGTGAGCCTCCTACCTGCTCCCCT
GAT
CAGTTTGCATGTACCACTGGTGAGATCGACTGCATCCCCGGAGCCTGGCGCTGTGACGGCTTCCCTG
AG
TGTGCTGACCAGAGTGATGAAGAAGGCTGCCCAGTGTGCTCCGCCTCTCAGTTCCCCTGCGCTCGAGG
C
CAGTGTGTGGACCTGCGGTTACGCTGCGACGGTGAGGCCGACTGCCAGGATCGCTCTGATGAAGCTAAC
TGC
GATGCTGTCTGTCTGCCCAATCAGTTCCGGTGCACCAGCGGCCAGTGTGTCCTCATCAAGCAACAGT
GT
GACTCCTTCCCCGACTGTGCTGATGGGTCTGATGAGCTCATGTGTGAAATCAACAAGCCACCCTCTGA
T
GACATCCCAGCCCACAGCAGTGCCATTGGGCCCGTCATTGGTATCATCCTCTCCCTCTTCGTCATGGGC
GGG
GTCTACTTTGTCTGCCAGCGTGTGATGTGCCAGCGCTACACAGGGGCCAGTGGGCCCTTTCCCCACG
AG
TATGTTGGTGGAGCCCCTCATGTGCCTCTCAACTTCATAGCCCCAGGTGGCTCACAGCACGGTCCCTT
C
CCAGGCATCCCGTGCAGCAAGTCCGTGATGAGCTCCATGAGCCTGGTGGGGGGGCGCGGCAGTGTGCCC
CTC
TATGACCGGAATCACGTCACTGGGGCCTCATCCAGCAGCTCGTCCAGCACAAAGGCCACACTATATC
CG
CCGATCCTGAACCCACCCCCGTCCCCGGCCACAGACCCCTCTCTCTACAACGTGGACGTGTTTTATTC
T
TCAGGCATCCCGGCCACCGCTAGACCATACAGGCCCTACGTCATTCGAGGTATGGCACCCCCAACAACA
CCG
TGCAGCACAGATGTGTGTGACAGTGACTACAGCACCAGTCGCTGGAAGAGCAGCAAATACTACCTGG
AC
TTGAATTCGGACTCAGACCCCTACCCCCCCCCGCCCACCCCCCACAGCCAGTACCTATCTGCAGAGGA
C
AGCTGCCCACCCTCACCAGGCACTGAGAGGAGTTACTGCCACCTCTTCCCGCCCCCACCGTCCCCCTGC
ACG
GACTCGTCCTGA


Translation (1614 aa):
METAPTRAPPPPPPPLLLLVLYCSLVPAAASPLLLFANRRDVRLVDAGGVKLESTIVASGLEDAAAVDFQ
F
SKGAVYWTDVSEEAIKQTYLNQTGAAAQNIVISGLVSPDGLACDWVGKKLYWTDSETNRIEVANLNGTS
R
KVLFWQDLDQPRAIALDPAH
GYMYWTDWGEAPRIERAGMDGSTRKIIVDSDIYWPNGLTIDLEEQKLYW
A
DAKLSFIHRANLDGSF
RQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKWTGEQRKEILSALYSP
M
DIQVLSQERQPP
FHTPCEEDNGGCSHLCLLSPREPFYSCACPTGVQLQDNGKTCKTGAEEVLLLARRTD
L
RRISLDTPDFTDIVLQVGDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDGSGAQTLVNTEINDPDGI
A
VDWVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAIVLHPVM
GLMYWTDWGENPKIECANLDG
R
DRHVLVNTSLGWPNGLALDLQEGKLYWGDAKTDKIE
VINIDGTKRKTLLEDKLPHIFGFTLLGDFIYWT
D
WQRRSIERVHKVKASRDVIIDQLPDLMGLKAVNVAKVV
GTNPCADGNGGCSHLCFFTPRATKCGCPIGL
E
LLSDMKTCIIPEAFLVFTSRATIHRISLETNNNDVAIPLTGVKEASALDFDVSNNHIYWTDVSLK
TISR
A
FMNGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPRSLALDPT
K
GYIYWTEWGGKPRIVRAFMDGTNCMTLVDKVGRANDLTIDYADQRLYWTDLDTNMIESSNMLGQERMVI
A
DDLPYPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQGHLDFVMDILVFHSSRQDGLNDCVHSNG
Q
CGQLCLAIPGGHRCGCASHYTLDPSSRNCS
PPSTFLLFSQKFAISRMIPDDQLSPDLVLPLHGLRNVKA
I
NYDPLDKFIYWVDGRQNIKRAKDDGTQ
PSMLTSPSQSLSPDRQPHDLSIDIYSRTLFWTCEATNTINVH
R
LDGDAMGVVLRGDRDKPRAIAVNAER
GYMYFTNMQDHAAKIERASLDGTEREVLFTTGLIRPVALVVDN
A
LGKLFWVDADLKRIESCDLS
GANRLTLEDANIVQPVGLTVLGRHLYWIDRQQQMIERVEKTTGDKRTRV
Q
GRVTHLTGIHAVEEVSLEEF
SAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSP
D
QFACTTGEIDCIPGAWRCDGFPECADQSDEEGCPVCSASQFPCARGQCVDLRLRCDGEADCQDRSDEAN
C
D
AVCLPNQFRCTSGQCVLIKQQCDSFPDCADGSDELMCEINKPPSDDIPAHSSAIGPVIGIILSLFVMG
G
VYFVCQRVMCQRYTGASGPFPHEYVGGAPHVPLNFIAPGGSQHGPFP
GIPCSKSVMSSMSLVGGRGSVP
L
YDRNHVTGASSSSSSSTKATLYPP
ILNPPPSPATDPSLYNVDVFYSSGIPATARPYRPYVIRGMAPPTT
P
CSTDVCDSDYSTSRWKSSKYYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPGTERSYCHLFPPPPSPC
T
DSS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser