NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS49727.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
49727.1 Public Mus musculus 15 Prph 21 106 86 CCDS HistoryNCBI Gene:19132Re-query CCDS DB by CCDS ID:49727.1Re-query CCDS DB by GeneID:19132See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 49727.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000024249 ENSMUSP00000024249 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000024249Link to Ensembl Protein Viewer:ENSMUSP00000024249Re-query CCDS DB by Nucleotide ID:ENSMUST00000024249Re-query CCDS DB by Protein ID:ENSMUSP00000024249
Original member Current member NCBI NM_001163589.1 NP_001157061.1 Accepted alive Link to Nucleotide Sequence:NM_001163589.1Link to Protein Sequence:NP_001157061.1Re-query CCDS DB by Nucleotide ID:NM_001163589Re-query CCDS DB by Protein ID:NP_001157061Link to BLAST:NP_001157061.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001157061.1 475 P15331-1 475 99.7895% 0 1

Chromosomal Locations for CCDS 49727.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 15 (NC_000081.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 99055207 99055763 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 99056104 99056164 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 99056341 99056436 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 99056769 99056936 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 99057033 99057158 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 99057258 99057478 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 99057568 99057617 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 99057816 99057895 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 99058602 99058670 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1428 nt):
ATGCCATCTTCCGCCAGCATGAGCCATCATCACTCGTCGGGCCTGCGGTCCAGCATCAGCTCCACCTCGT
AC
CGCCGGACCTTTGGGCCGCCGCCCTCACTGTCCCCCGGGGCTTTCTCCTACTCGTCCAGCTCTCGCTT
C
TCCAGCAGCCGCCTGCTGGGCTCGGGGTCCCCGAGCTCCTCGGCGCGGCTGGGCAGCTTCCGTGCCCCT
CGA
GCGGGGGCACTGCGCTTGCCCTCGGAGCGCCTCGATTTCTCCATGGCCGAGGCCCTCAACCAAGAGT
TC
CTGGCCACTCGGAGCAACGAGAAGCAAGAGTTACAGGAGCTCAACGACCGCTTCGCCAACTTCATCGA
G
AAGGTGCGCTTCTTGGAGCAGCAGAACGCAGCCCTGCGCGGGGAGCTGAGCCAGGCGCGGGGCCAGGAG
CCG
GCGCGCGCCGACCAGCTTTGCCAGCAGGAGCTGCGCGAGCTGCGGCGCGAACTGGAGCTGCTGGGCC
GG
GAGCGCGACCGGGTGCAGGTGGAGCGGGACGGGCTGGCGGAGGACCTAGCGGCGCTCAAGCAGAGGTT
A
GAAGAAGAAACCCGCAAGCGGGAGGATGCGGAGCACAACCTGGTGCTCTTCCGTAAGGACGTGGACGAC
GCC
ACTCTGTCCCGCCTAGAACTGGAGCGCAAGATTGAGTCTCTGATGGATGAAATTGAGTTCCTCAAGA
AG
CTACACGAAGAGGAACTTCGAGACCTGCAGGTGAGCGTAGAGAGCCAGCAGGTGCAGCAGGTGGAGGT
A
GAGGCAACAGTGAAGCCAGAGCTGACGGCGGCGCTGAGGGACATCCGTGCACAGTACGAGAACATCGCG
GCA
AAGAATCTGCAGGAGGCAGAGGAGTGGTATAAGTCGAAATATGCTGACCTGTCGGACGCCGCCAACC
GC
AACCATGAGGCCCTACGCCAGGCCAAGCAAGAGATGAACGAGTCTCGACGTCAGATCCAGAGTCTGAT
G
TGCGAGGTGGATGGGCTGCGAGGCACGAATGAGGCGCTGCTCAGACAGCTGCGGGAGCTGGAAGAGCAG
TTC
GCCCTGGAGGCTGGAGGGTACCAAGCAGGCGCAGCACGGCTGGAGGAAGAGCTTCGACAGCTGAAGG
AA
GAGATGGCGAGGCACCTGCGAGAGTACCAGGAGCTCCTTAACGTCAAGATGGCCCTGGACATCGAGAT
A
GCCACCTACAGGAAGCTACTGGAAGGGGAGGAGAGCCGGATCTCAGTGCCGGTTCATTCCTTTGCCTCT
CTA
AGTTTAAAGACGACTGTGCCTGAGATGGAGCCTCTCCAGGATAGCCACAGCAAGAAGATGGTTCTGA
TC
AGGACAATTGAGACCCGGGATGGGGAGAAGGTGGTGACAGAGTCCCAGAAGGAACAGCACAGTGACCT
G
GACAAGTCTTCTATCCACAGCTACTGA


Translation (475 aa):
MPSSASMSHHHSSGLRSSISSTSYRRTFGPPPSLSPGAFSYSSSSRFSSSRLLGSGSPSSSARLGSFRAP
R
AGALRLPSERLDFSMAEALNQEFLATRSNEKQELQELNDRFANFIEKVRFLEQQNAALRGELSQARGQE
P
ARADQLCQQELRELRRELELLGRERDRVQVERDGLAEDLAALKQ
RLEEETRKREDAEHNLVLFRKDVDD
A
TLSRLELERKIESLMDEIEFLKKLHEE
ELRDLQVSVESQQVQQVEVEATVKPELTAALRDIRAQYENIA
A
KNLQEAEEWYKSK
YADLSDAANRNHEALRQAKQEMNESRRQIQSLMCEVDGLRGTNEALLRQLRELEEQ
F
ALEAGGYQAGAARLEEELRQLKEEMARHLREYQELLNVKMALDIEIATYRKLLEGEES
RISVPVHSFAS
L
SLKTT
VPEMEPLQDSHSKKMVLIRTIETRDGEKVVTESQKEQHSDLDKSSIHSY



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser