NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS24857.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
24857.1 Public Mus musculus 11 Myh8 21 106 86 CCDS HistoryNCBI Gene:17885Re-query CCDS DB by CCDS ID:24857.1Re-query CCDS DB by GeneID:17885See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 24857.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000019625 ENSMUSP00000019625 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000019625Link to Ensembl Protein Viewer:ENSMUSP00000019625Re-query CCDS DB by Nucleotide ID:ENSMUST00000019625Re-query CCDS DB by Protein ID:ENSMUSP00000019625
Original member Current member EBI,WTSI OTTMUST00000013184 OTTMUSP00000006120 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000013184Link to Vega Protein Viewer:OTTMUSP00000006120Re-query CCDS DB by Nucleotide ID:OTTMUST00000013184Re-query CCDS DB by Protein ID:OTTMUSP00000006120
Original member Current member NCBI NM_177369.3 NP_796343.2 Accepted alive Link to Nucleotide Sequence:NM_177369.3Link to Protein Sequence:NP_796343.2Re-query CCDS DB by Nucleotide ID:NM_177369Re-query CCDS DB by Protein ID:NP_796343Link to BLink:NP_796343.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_796343.2 1937 P13542 1937 100% 0 0

Chromosomal Locations for CCDS 24857.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 11Link to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 67278857 67279066 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 67279890 67280033 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 67280119 67280275 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 67283252 67283279 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 67283378 67283486 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 67283577 67283669 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 67283802 67283865 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 67284433 67284531 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 67284625 67284728 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 67284883 67285021 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 67286171 67286289 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 67286376 67286525 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 67288199 67288369 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 67289527 67289836 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 67289943 67290010 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 67292179 67292266 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 67292350 67292467 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 67292636 67292759 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 67292842 67292978 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 67294357 67294612 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 67297092 67297334 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 67297446 67297622 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 67297702 67297847 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 67297929 67298019 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 67298345 67298734 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 67299271 67299397 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 67299713 67299831 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 67299955 67300151 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 67301401 67301584 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 67301659 67301824 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 67301913 67302037 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 67303618 67303926 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 67304324 67304527 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 67305622 67305747 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 67305835 67306005 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 67306154 67306258 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 67306877 67306972 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 67308334 67308483 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (5814 nt):
ATGAGTGCGGGTTCGGACGCGGAGATGGCTATTTTTGGCGAAGCTGCTCCTTACCTCCGAAAATCGGAGA
AG
GAGAGGATTGAGGCCCAAAATAAGCCTTTTGACGCAAAAACATCTGTCTTTGTGGCGGAGCCCAAGGA
G
TCTTATGTGAAAAGCGTTATACAAAGCAAGGATGGAGGGAAAGTGACCGTGAAGACGGAAAGTGGAGCA
ACT
CTCACCGTCAAGGAAGATCAAGTCTTCCCCATGAACCCTCCCAAATATGACAAGATCGAGGACATGG
CC
ATGATGACCCACCTCCATGAGCCCGGAGTGCTGTACAACCTCAAAGAGCGTTATGCAGCCTGGATGAT
C
TATACCTACTCAGGCCTCTTCTGTGTCACCGTCAACCCCTACAAGTGGCTGCCGGTGTACAACCCTGAG
GTG
GTGGCAGCCTACCGAGGCAAAAAGCGCCAGGAGGCCCCACCCCACATCTTCTCCATCTCTGACAACG
CC
TACCAGTTCATGCTGACGGATCGTGAGAACCAGTCCATCCTGATCACCGGAGAATCCGGGGCCGGGAA
G
ACTGTGAACACGAAGCGTGTCATCCAGTACTTTGCAACAATTGCAGTCACTGGGGACAAGAAGAAGGAG
GAG
TCTGGCAAAATGCAGGGGACCCTGGAAGATCAAATCATCAGTGCTAACCCCCTGCTGGAGGCCTTTG
GG
AACGCCAAGACCGTGAGGAATGACAACTCATCTCGCTTTGGCAAGTTCATCAGAATCCACTTCGGTAC
C
ACGGGGAAACTGGCATCAGCTGATATTGAAACCTATCTTCTAGAGAAGTCTAGAGTCACTTTCCAGCTA
AAA
GCTGAAAGAAGTTACCACATTTTTTATCAGATCACCTCCAATAAGAAGCCAGAGCTAATTGAAATGC
TC
CTGATCACCACCAACCCGTATGACTACGCCTTTGTCAGTCAGGGGGAGATCACGGTGCCCAGCATTGA
T
GACCAAGAAGAGTTGATGGCCACAGATAGTGCCATTGATATCCTTGGCTTTTCACCTGAAGAGAAAGTG
TCC
ATCTATAAACTCACAGGGGCTGTGATGCATTATGGGAACATGAAGTTCAAGCAAAAGCAGCGGGAGG
AG
CAGGCTGAGCCAGATGGCACTGAAGTGGCTGACAAGGCTGCCTATCTCCAGTGTCTGAACTCTGCTGA
T
CTGCTCAAAGCCCTCTGCTATCCCAGGGTCAAGGTTGGCAATGAATATGTCACCAAAGGCCAGACGGTT
CAA
CAAGTGTATAATGCGGTGGGTGCCCTGGCCAAGGCTGTCTATGAGAAGATGTTCCTGTGGATGGTCA
CC
CGCATCAACCAGCAGCTGGACACCAAGCAGCCCCGGCAGTACTTCATCGGGGTCTTGGACATCGCTGG
C
TTTGAGATCTTTGATTTCAACAGCCTGGAGCAGCTGTGCATCAACTTCACCAATGAGAAACTGCAACAG
TTT
TTCAACCACCACATGTTCGTGCTGGAGCAGGAGGAGTACAAGAAGGAAGGCATCGAGTGGACCTTCA
TC
GACTTCGGGATGGACCTGGCGGCCTGCATCGAGCTCATTGAGAAGCCACTGGGCATCTTCTCCATCCT
G
GAAGAAGAGTGCATGTTCCCTAAGGCGACAGACACCTCCTTCAAGAACAAGCTGTACGACCAACATCTG
GGA
AAATCCAACAACTTCCAGAAGCCCAAGCCTACCAAAGGCAAGGCCGAGGCCCACTTCTCCCTGGTGC
AC
TATGCGGGCACTGTGGATTACAACATCACCGGCTGGCTGGACAAGAACAAGGACCCCCTGAATGACAC
C
GTGGTGGGGCTGTACCAGAAGTCAGCAATGAAAACTCTGGCCAGCCTCTTTTCCACATACGCTAGTGCT
GAA
GCAGATGGTGGTGCAAAGAAAGGAGCTAAGAAGAAGGGCTCTTCTTTCCAAACTGTGTCAGCCCTTT
TC
AGGGAAAACTTAAATAAACTGATGACCAATCTGAGAAGTACACACCCTCACTTCGTACGGTGTATCAT
T
CCCAATGAAACGAAGACTCCCGGTGCCATGGAGCACGAACTGGTCCTGCACCAGCTGAGGTGTAACGGG
GTG
CTGGAGGGCATCCGCATCTGCAGGAAGGGGTTCCCCAGCCGGATCCTGTATGGGGACTTTAAGCAGA
G
A
TACAAGGTTTTAAATGCAAGTGCTATTCCAGAGGGACAGTTCATCGACAGCAAGAAGGCCTCTGAGAA
G
CTTCTGGGCTCTATTGATATCGATCACACTCAGTATAAATTTGGACACACCAAGGTTTTCTTCAAAGCT
GGT
CTCCTGGGTCTCCTGGAAGAAATGAGAGATGAAAAGCTGGCCCAGATTATAACAAGAACCCAGGCGG
TC
TGTAGGGGATACCTAATGAGAGTGGAGTATCAGAAGATGCTGCTGAGAAGAGAATCCATCTTCTGTAT
C
CAGTACAACGTCCGCGCCTTCATGAACGTCAAGCACTGGCCCTGGATGAAACTCTTCTTCAAGATCAAA
CCC
CTGCTGAAGAGCGCAGAGACCGAGAAGGAGATGGCCACCATGAAGGAGGAGTTCCAGAAAACCAAGG
AT
GAGCTGGCCAAGTCGGAGGCAAAGCGGAAGGAGCTGGAGGAGAAGATGGTCACTCTTCTCAAAGAGAA
A
AATGACCTGCAACTCCAGGTTCAATCTGAAGCAGACAGCTTGGCCGATGCTGAGGAAAGGTGTGAACAA
TTG
ATCAAAAACAAAATCCAGCTGGAGGCCAAAATCAAAGAGGTGACCGAGAGGGCCGAGGACGAGGAGG
AG
ATCAACGCGGAGCTCACGGCCAAGAAGAGGAAGCTGGAGGACGAGTGCTCAGAGCTGAAGAAGGACAT
C
GATGACCTTGAGCTGACACTGGCCAAGGTTGAGAAGGAGAAGCACGCCACGGAGAACAAGGTGAAAAAC
CTG
ACAGAGGAGATGGCAGGCCTGGATGAAAATATCGCCAAGCTGACCAAGGAGAAGAAGGCCCTCCAGG
AG
GCCCACCAGCAGACCCTGGATGACCTGCAGGCAGAGGAGGACAAAGTCAACACCCTGACCAAAGCCAA
A
ACCAAGCTGGAACAGCAAGTGGATGACCTTGAGGGATCGCTAGAGCAAGAAAAGAAGCTGAGGATGGAC
TTA
GAAAGAGCCAAGAGGAAACTGGAGGGGGACCTGAAACTGGCCCAAGAGTCCACAATGGACATAGAAA
AC
GATAAACAGCAGCTTGATGAGAAACTCAAAAAGAAGGAGTTTGAAATCAGCAACCTGATAAGCAAAAT
T
GAAGATGAGCAAGCTGTGGAGATCCAGCTGCAGAAGAAGATCAAAGAGTTGCAGGCCCGCATCGAGGAG
CTG
GAGGAGGAAATCGAGGCAGAGCGGGCCTCCAGGGCCAAAGCAGAGAAGCAGCGCTCTGACCTCTCCC
GG
GAACTGGAGGAGATCAGCGAGAGGCTGGAAGAAGCCGGCGGGGCCACCTCTGCTCAGGTGGAGATGAA
C
AAGAAGCGGGAAACTGAGTTTCAGAAACTTCGCCGGGACCTGGAGGAGGCCACGCTGCAGCACGAAGCC
ACA
GCAGCCGCTCTTCGGAAGAAGCACGCGGACAGTGTGGCTGAGCTCGGGGAGCAGATCGACAACCTGC
AG
CGGGTGAAGCAGAAGCTGGAGAAGGAGAAGAGCGAGCTGAAGATGGAGATCGATGACCTTAGCAGTAA
T
GCAGAGGCCATCGCCAAAGCCAAGGGAAATCTGGAGAAGATGTGCCGCACTCTGGAGGACCAGGTGAGT
GAA
CTGAAGAGCAAGGAGGAGGAGCAGCAGCGGCTCATCAACGAGCTGACAGCGCAGAGAGCACGCCTGC
AG
ACAGAAGCAGGTGAGTACTCCAGACAGCTGGATGAGAAAGATGCTTTAGTCTCTCAGTTGTCAAGGAG
C
AAGCAGGCATCCACGCAGCAGATTGAGGAGCTGAAGCGTCAGCTCGAGGAAGAAACCAAGGCCAAGAAC
GCG
CTGGCCCACGCCCTGCAGTCCTCCCGCCACGACTGTGATCTGCTGCGGGAACAGTATGAAGAGGAGC
AG
GAAGGCAAAGCCGAGCTGCAGAGGGCACTGTCCAAGGCCAACAGCGAGGTGGCCCAGTGGAGGACCAA
A
TATGAGACCGATGCCATCCAGCGCACAGAGGAGCTGGAGGAGGCCAAGAAGAAGCTGGCTCAGCGTCTG
CAG
GCGGCCGAGGAGCACGTAGAAGCCGTGAACGCCAAGTGCGCTTCCCTGGAGAAGACGAAGCAGCGGC
TG
CAGAACGAGGTGGAGGACCTCATGATTGATGTGGAGAGGACCAACGCGGCCTGCGCCGCCCTGGACAA
G
AAGCAGAGAAACTTCGACAAGGTTCTATCAGAATGGAGACAGAAGTATGAGGAAACTCAGGCTGAGCTT
GAG
TCCTGCCAGAAGGAGTCCCGAACTCTCAGCACGGAGCTGTTCAAGGTGAAGAACGCCTACGAGGAGT
CT
CTGGACCACCTGGAGACGCTGAGGAGAGAGAACAAGAATCTGCAACAGGAGATCTCTGACCTGACTGA
G
CAGATTGCAGAGGGAGGGAAGCACATCCATGAGCTGGAGAAAATCAAGAAGCAAGTGGAACAGGAGAAG
TGT
GAGATACAGGCTGCCTTAGAGGAAGCAGAGGCATCTCTGGAGCACGAGGAGGGAAAGATCCTGCGCA
TC
CAGCTGGAGCTGAACCAAGTCAAGTCTGAGATCGACAGGAAGATTGCTGAGAAGGATGAGGAGATCGA
C
CAGCTGAAGAGGAACCACGTTAGAGTCGTGGAGACCATGCAGAGCACGCTGGATGCCGAGATCAGGAGC
AGG
AATGATGCTCTGAGAGTCAAGAAGAAGATGGAGGGAGACCTGAACGAGATGGAGATCCAGCTGAACC
AC
GCCAACCGCTTGGCTGCTGAAAGTTTGAGGAACTACAGGAACACACAGGGCATCCTCAAGGACACCCA
G
CTGCATCTGGATGACGCTCTCCGGGGCCAGGAGGATCTGAAGGAGCAGCTGGCCATCGTGGAGCGCAGA
GCC
AACCTGCTGCAGGCTGAGATTGAGGAGCTGCGGGCCACGCTGGAGCAGACGGAGAGGAGCAGGAAGA
TT
GCAGAGCAGGAGCTGCTGGACGCCAGTGAGCGCGTGCAGCTCCTCCACACCCAGAACACGAGCCTCAT
C
AACACCAAGAAGAAGCTGGAAAATGATGTTTCACAGCTGCAGAGTGAAGTGGAAGAAGTGATTCAAGAG
TCA
CGCAATGCAGAAGAGAAGGCTAAGAAAGCCATTACTGATGCCGCCATGATGGCGGAGGAGCTGAAGA
AG
GAGCAGGACACCAGCGCCCACCTGGAGCGGATGAAGAAGAACATGGAACAGACGGTGAAGGACCTGCA
G
CACCGTCTGGACGAGGCTGAGCAGCTGGCGCTGAAGGGCGGCAAGAAGCAGATCCAGAAACTGGAGGCC
AGG
GTACGTGAACTTGAAGGAGAGGTCGAAAATGAACAGAAACGCAATGCTGAGGCTGTTAAAGGGTTAA
GG
AAGCATGAAAGAAGAGTAAAGGAACTTACCTACCAGACTGAGGAAGACCGCAAGAATGTGCTCCGGCT
G
CAGGACCTGGTGGACAAATTACAGGCGAAGGTGAAATCCTACAAGAGACAGGCTGAGGAGGCTGAGGAA
CAA
TCCAATGCCAACCTGGCCAAGTTCCGCAAGCTGCAGCACGAGCTGGAGGAAGCCGAGGAGCGGGCTG
AC
ATCGCCGAGTCCCAGGTCAACAAGCTGCGGGTGAAGAGCCGGGAGGTTCACACCAAAATCAGCGCAGA
G
TAA


Translation (1937 aa):
MSAGSDAEMAIFGEAAPYLRKSEKERIEAQNKPFDAKTSVFVAEPKESYVKSVIQSKDGGKVTVKTESGA
T
LTVKEDQVFPMNPPKYDKIEDMAMMTHLHEPGVLYNLKERYAAWMIY
TYSGLFCVTVNPYKWLPVYNPE
V
VAAYRGKKRQEAPPHIFSISDNAYQFMLT
DRENQSILITGESGAGKTVNTKRVIQYFATIAVTGDKKKE
E
SGKMQ
GTLEDQIISANPLLEAFGNAKTVRNDNSSRFGKFIRIHFGTTGKLASADIETYLLEKSRVTFQL
K
AERSYHIFYQITSNKKPELI
EMLLITTNPYDYAFVSQGEITVPSIDDQEELMATDSAIDILGFSPEEKV
S
IYKLTGAVMHYGNMKFKQKQREEQAEPDGTE
VADKAAYLQCLNSADLLKALCYPRVKVGNEYVTKGQTV
Q
Q
VYNAVGALAKAVYEKMFLWMVTRINQQLDTKQPRQYFIGVLDIAGFEIFDFNSLEQLCINFTNEKLQQ
F
FNHHMFVLEQEEYKKEGIEWTFIDFGMDLAACIELIEK
PLGIFSILEEECMFPKATDTSFKNKLYDQHL
G
KSNNFQKPKPTKGKAEAHFSLVHYAGTVDYNITGWLDKNKDPLNDTVVGLYQKSAMKTLASLFSTYASA
E
A
DGGAKKGAKKKGSSFQTVSALFRENLNKLMTNLRSTHPHFVRCIIPNETKTPGAMEHELVLHQLRCNG
V
LEGIRICRKGFPSRILYGDFKQ
RYKVLNASAIPEGQFIDSKKASEKLLGSIDIDHTQYKFGHTKVFFKA
G
LLGLLEEMRDEKLAQIITRTQAVCRGYLMRVEYQKMLLR
RESIFCIQYNVRAFMNVKHWPWMKLFFKIK
P
LLKSAETEKEMATMKEEFQKTKDELAKSEAKRKELEEKMVTLLKEKNDLQLQVQS
EADSLADAEERCEQ
L
IKNKIQLEAKIKEVTERAEDEEEINAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENK
VKN
L
TEEMAGLDENIAKLTKEKKALQEAHQQTLDDLQAEEDKVNTLTKAKTKLEQQVDD
LEGSLEQEKKLRMD
L
ERAKRKLEGDLKLAQESTMDIENDKQQLDEKLK
KKEFEISNLISKIEDEQAVEIQLQKKIKELQARIEE
L
EEEIEAERASRAKAEKQRSDLSRELEEISERLEEAGGATSAQVEMNKKRETEFQKLRRDLEEATLQHEA
T
AAALRKKHADSVAELGEQIDNLQRVKQKLEKEKSELKMEIDDLSSNAEAIAKAK
GNLEKMCRTLEDQVS
E
LKSKEEEQQRLINELTAQRARLQTEA
GEYSRQLDEKDALVSQLSRSKQASTQQIEELKRQLEEETKAKN
A
LAHALQSSRHDCDLLREQYEEEQEGKAELQRALSKANSEVAQWRTKYETDAIQRTEELEEA
KKKLAQRL
Q
AAEEHVEAVNAKCASLEKTKQRLQNEVEDLMIDVERTNAACAALDKKQRNFDK
VLSEWRQKYEETQAEL
E
SCQKESRTLSTELFKVKNAYEESLDHLETLRRENKNLQ
QEISDLTEQIAEGGKHIHELEKIKKQVEQEK
C
EIQAALEEAE
ASLEHEEGKILRIQLELNQVKSEIDRKIAEKDEEIDQLKRNHVRVVETMQSTLDAEIRS
R
NDALRVKKKMEGDLNEMEIQLNHANRLAAESLRNYRNTQGILK
DTQLHLDDALRGQEDLKEQLAIVERR
A
NLLQAEIEELRATLEQTERSRKIAEQELLDASERVQLLHTQ
NTSLINTKKKLENDVSQLQSEVEEVIQE
S
RNAEEKAKKAITD
AAMMAEELKKEQDTSAHLERMKKNMEQTVKDLQHRLDEAEQLALKGGKKQIQKLEA
R
VRELEGEVENEQKRNAEAVKGLRKHERRVKELTYQTEEDRKNVLRLQDLVDKLQAKVKSYKRQAEEAEE
Q
SNANLAKFRKLQHELEEAEERADIAESQVNKLRVKSREVHTKISAE




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser