NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS51529.1 (previous version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
51529.1 Public Mus musculus 5 Igfbp7 16 104 75 CCDS HistoryNCBI Gene:29817Re-query CCDS DB by CCDS ID:51529.1Re-query CCDS DB by GeneID:29817See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Sequence IDs included in CCDS 51529.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000046746 ENSMUSP00000045057 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000046746Link to Ensembl Protein Viewer:ENSMUSP00000045057Re-query CCDS DB by Nucleotide ID:ENSMUST00000046746Re-query CCDS DB by Protein ID:ENSMUSP00000045057
Original member Current member NCBI NM_008048.3 NP_032074.3 Accepted alive Link to Nucleotide Sequence:NM_008048.3Link to Protein Sequence:NP_032074.3Re-query CCDS DB by Nucleotide ID:NM_008048Re-query CCDS DB by Protein ID:NP_032074Link to BLAST:NP_032074.3

Chromosomal Locations for CCDS 51529.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 77349480 77349499 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 77351228 77351354 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 77351913 77352029 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 77355562 77355671 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 77407540 77408014 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (849 nt):
ATGATGGAGCGGCCGCCGCGCGCCCTGCTGCTGGGTGCAGCCGGACTGCTGCTCCTGCTCCTGCCCCTCT
CC
TCTTCCTCCTCTTCGGATGCCTGCGGCCCGTGCGTGCCGGCCTCCTGCCCCGCGCTGCCCCGGCTCGG
C
TGCCCGCTGGGTGAGACCCGCGACGCGTGCGGGTGCTGCCCGGTGTGTGCTCGCGGCGAGGGTGAGCCG
TGC
GGGGGCGGCGCGGCCGGCAGGGGGCACTGCGCGCCGGGCATGGAGTGCGTGAAGAGCCGCAAGAGGC
GG
AAGGGTAAAGCCGGGGCAGCAGCCGGCGGTCCCGCGACCCTCGCCGTGTGCGTGTGCAAGAGCCGCTA
C
CCGGTGTGCGGCAGCAACGGCATCACCTACCCCAGCGGCTGCCAGCTGCGCGCTGCCAGCCTGCGCGCC
GAG
AGCCGCGGGGAGAAGGCCATCACCCAGGTCAGCAAGGGCACCTGCGAGCAAGGTCCTTCCATAGTGA
CG
CCCCCCAAGGACATCTGGAACGTCACTGGTGCCAAGGTGTTCTTGAGCTGTGAGGTCATCGGGATCCC
A
ACCCCTGTCCTCATCTGGAACAAGGTAAAAAGGGATCACTCTGGAGTTCAGCGGACAGAACTCTTGCCT
GGT
GACCGGGAAAATCTGGCCATTCAGACCCGGGGTGGTCCAGAAAAGCATGAAGTAACGGGCTGGGTGC
TG
GTATCTCCTCTAAGTAAGGAGGACGCTGGAGAGTATGAGTGCCACGCATCCAACTCCCAAGGGCAGGC
T
TCCGCGGCAGCCAAAATTACAGTGGTTGATGCCCTCCATGAAATACCACTGAAAAAAGGTGAAGGTGCT
CAG
TTATAA


Translation (282 aa):
MMERPPRALLLGAAGLLLLLLPLSSSSSSDACGPCVPASCPALPRLGCPLGETRDACGCCPVCARGEGEP
C
GGGAAGRGHCAPGMECVKSRKRRKGKAGAAAGGPATLAVCVCKSRYPVCGSNGITYPSGCQLRAASLRA
E
SRGEKAITQVSKGTCEQ
GPSIVTPPKDIWNVTGAKVFLSCEVIGIPTPVLIWNKVKRDHSGVQRTELLP
G
DRENLAIQTRGGPEKHEVTGWVL
VSPLSKEDAGEYECHASNSQGQASAAAKITVVDALHEIPLKKGEGA
Q
L




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser