NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS19150.1 (previous version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19150.1 Public Mus musculus 5 Mnx1 16 104 75 CCDS HistoryNCBI Gene:15285Re-query CCDS DB by CCDS ID:19150.1Re-query CCDS DB by GeneID:15285See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 19150.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000165512 ENSMUSP00000129503 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000165512Link to Ensembl Protein Viewer:ENSMUSP00000129503Re-query CCDS DB by Nucleotide ID:ENSMUST00000165512Re-query CCDS DB by Protein ID:ENSMUSP00000129503
Original member Current member EBI,WTSI OTTMUST00000096750 OTTMUSP00000054092 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000096750Link to Vega Protein Viewer:OTTMUSP00000054092Re-query CCDS DB by Nucleotide ID:OTTMUST00000096750Re-query CCDS DB by Protein ID:OTTMUSP00000054092
Original member Current member NCBI NM_019944.2 NP_064328.2 Accepted alive Link to Nucleotide Sequence:NM_019944.2Link to Protein Sequence:NP_064328.2Re-query CCDS DB by Nucleotide ID:NM_019944Re-query CCDS DB by Protein ID:NP_064328Link to BLink:NP_064328.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_064328.2 404 Q9QZW9 404 99.505% 0 2

Chromosomal Locations for CCDS 19150.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 5Link to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 29473869 29474231 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 29474756 29474916 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 29477585 29478275 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1215 nt):
ATGGAAAAATCCAAAAATTTCCGCATCGACGCCCTGCTGGCCGTGGATCCCCCGCGAGCCGCCTCCACGC
AG
AGCGCGCCTCTGGCCTTGGTCACTTCCCTCGCGACTACAGTATCTGGTCCCGGCCGCGGCGGCAGCGG
C
GGCGGGGGGACCAGTAGCGGGGCGAGCCGTAGCTGCAGTCCCGCATCCTCGGAGGCCACTGCAGCGCCC
GGT
GACCGGCTGAGAGCTGAGAGCCCGTCGCCCCCACGCTTGCTGGCTGCACACTGCGCGCTGCTGCCCA
AG
CCCGGATTCCTGGGCGCCGGAGGAGGCGGCGGCGCGGCGGGTGGGCCGGGCACTCCCCACCACCACGC
G
CACCCTGGTGCAGCAGCCGCCGCGGCTGCCGCTGCCGCTGCCGCGGCTGCCGGTGGCCTGGCACTGGGG
CTG
CACCCGGGGGGCGCACAGGGCGGCGCGGGCCTCCCTGCACAGGCGGCTCTCTATGGACACCCGGTCT
AC
AGTTATTCGGCAGCAGCTGCAGCGGCCGCGCTAGCTGGCCAGCACCCGGCGCTTTCCTACTCATACCC
T
CAGGTGCAGGGCGCGCACCCTGCGCACCCTGCCGACCCCATCAAGCTGGGTGCCAGCACCTTCCAACTG
GAC
CAGTGGCTGCGCGCGTCTACTGCGGGCATGATCCTGCCCAAGATGCCGGACTTCAGCTCCCAGGCGC
AG
TCGAACCTCTTGGGGAAGTGCCGAAGGCCTCGCACGGCCTTCACCAGCCAGCAGCTGTTGGAGCTGGA
A
CACCAGTTCAAGCTCAACAAGTACCTGTCTCGACCCAAGCGTTTTGAGGTGGCTACCTCGCTCATGCTC
ACC
GAGACTCAGGTGAAGATTTGGTTCCAGAACCGCCGAATGAAATGGAAACGCAGCAAAAAGGCCAAAG
AG
CAGGCTGCGCAGGAGGCGGAGAAGCAGAAGGGCGGCGGCGGGGGCACCGGCAAAGGCGGCAGTGAGGA
G
AAGACGGAAGAGGAGCTGATGGGGCCTCCGGTTTCGGGGGACAAGGCAAGCGGCCGTCGCCTGCGGGAC
TTG
CGGGACAGTGACCCTGATGAGGACGAGGATGATGAAGAAGAGGACAACTTCCCGTACAGCAATGGTG
CC
GGTGCCCATGCTGCCTCATCCGACTGCTCATCTGAGGACGACTCGCCTCCTCCAAGACTAGGCGGGCC
T
GGACACCAACCTCTGCCCCAGTAG


Translation (404 aa):
MEKSKNFRIDALLAVDPPRAASTQSAPLALVTSLATTVSGPGRGGSGGGGTSSGASRSCSPASSEATAAP
G
DRLRAESPSPPRLLAAHCALLPKPGFLGAGGGGGAAGGPGTPHHHAHPGAAAAAAAAAAAAAAGGLALG
L
HPGGAQGGAGLPAQAALYGHPVYSYSAAAAAAALAGQHPALSYSYPQVQGAHPAHPADPIKLGASTFQL
D
QWLRASTAGMILPKMPDFS
SQAQSNLLGKCRRPRTAFTSQQLLELEHQFKLNKYLSRPKRFEVATSLML
T
ETQ
VKIWFQNRRMKWKRSKKAKEQAAQEAEKQKGGGGGTGKGGSEEKTEEELMGPPVSGDKASGRRLRD
L
RDSDPDEDEDDEEEDNFPYSNGAGAHAASSDCSSEDDSPPPRLGGPGHQPLPQ




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser