NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS26492.1 (previous version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
26492.1 Public Mus musculus 13 Id4 16 104 75 CCDS HistoryNCBI Gene:15904Re-query CCDS DB by CCDS ID:26492.1Re-query CCDS DB by GeneID:15904See the combined annotation on chromosome 13 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 26492.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000021810 ENSMUSP00000021810 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000021810Link to Ensembl Protein Viewer:ENSMUSP00000021810Re-query CCDS DB by Nucleotide ID:ENSMUST00000021810Re-query CCDS DB by Protein ID:ENSMUSP00000021810
Original member Current member NCBI NM_031166.2 NP_112443.1 Accepted alive Link to Nucleotide Sequence:NM_031166.2Link to Protein Sequence:NP_112443.1Re-query CCDS DB by Nucleotide ID:NM_031166Re-query CCDS DB by Protein ID:NP_112443Link to BLink:NP_112443.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_112443.1 161 P41139 161 100% 0 0

Chromosomal Locations for CCDS 26492.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '+' strand of Chromosome 13 (NC_000079.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 13Link to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13See the combined annotation on chromosome 13 in Sequence Viewer

Chromosome Start Stop Links
13 48261498 48261938 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 48262285 48262329 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (486 nt):
ATGAAGGCGGTGAGCCCGGTGCGCCCCTCGGGCCGCAAGGCGCCGTCGGGCTGCGGCGGCGGGGAGCTGG
CG
CTACGCTGCCTGGCGGAGCACGGCCACAGCCTGGGTGGCTCGGCAGCCGCCGCCGCCGCTGCGGCGGC
C
GCGCGCTGCAAGGCGGCCGAGGCGGCGGCCGATGAGCCGGCGCTGTGCCTGCAGTGCGATATGAACGAC
TGC
TACAGTCGCCTGCGGAGGCTCGTGCCTACCATCCCGCCCAACAAGAAAGTCAGCAAAGTGGAGATCC
TG
CAGCACGTTATCGACTACATCCTGGACCTGCAGCTGGCGCTGGAGACTCACCCTGCTTTGCTGAGACA
G
CCGCCACCGCCCGCGCCACCTCTCCACCCGGCCGGGGCTTGTCCGGTCGCGCCGCCGCGGACCCCACTC
ACC
GCGCTCAACACTGACCCGGCCGGCGCCGTGAACAAGCAGGGTGACAGCATTCTCTGCCGCTGA


Translation (161 aa):
MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEPALCLQCDMND
C
YSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPPPAPPLHPAGACPVAPPRTPL
T
ALNTDP
AGAVNKQGDSILCR



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser