NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS36592.1 (previous version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
36592.1 Public Mus musculus 13 Lgals8 16 104 75 CCDS HistoryNCBI Gene:56048Re-query CCDS DB by CCDS ID:36592.1Re-query CCDS DB by GeneID:56048See the combined annotation on chromosome 13 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Sequence IDs included in CCDS 36592.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000099820 ENSMUSP00000097408 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000099820Link to Ensembl Protein Viewer:ENSMUSP00000097408Re-query CCDS DB by Nucleotide ID:ENSMUST00000099820Re-query CCDS DB by Protein ID:ENSMUSP00000097408
Original member Current member EBI,WTSI ENSMUST00000099821 ENSMUSP00000097409 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000099821Link to Ensembl Protein Viewer:ENSMUSP00000097409Re-query CCDS DB by Nucleotide ID:ENSMUST00000099821Re-query CCDS DB by Protein ID:ENSMUSP00000097409
Original member Current member EBI,WTSI ENSMUST00000124888 ENSMUSP00000115094 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000124888Link to Ensembl Protein Viewer:ENSMUSP00000115094Re-query CCDS DB by Nucleotide ID:ENSMUST00000124888Re-query CCDS DB by Protein ID:ENSMUSP00000115094
Original member Current member EBI,WTSI OTTMUST00000085010 OTTMUSP00000045879 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000085010Link to Vega Protein Viewer:OTTMUSP00000045879Re-query CCDS DB by Nucleotide ID:OTTMUST00000085010Re-query CCDS DB by Protein ID:OTTMUSP00000045879
Original member Current member EBI,WTSI OTTMUST00000085013 OTTMUSP00000045882 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000085013Link to Vega Protein Viewer:OTTMUSP00000045882Re-query CCDS DB by Nucleotide ID:OTTMUST00000085013Re-query CCDS DB by Protein ID:OTTMUSP00000045882
Original member Current member NCBI NM_001199043.1 NP_001185972.1 Accepted alive Link to Nucleotide Sequence:NM_001199043.1Link to Protein Sequence:NP_001185972.1Re-query CCDS DB by Nucleotide ID:NM_001199043Re-query CCDS DB by Protein ID:NP_001185972Link to BLAST:NP_001185972.1
Original member Current member NCBI NM_018886.5 NP_061374.1 Accepted alive Link to Nucleotide Sequence:NM_018886.5Link to Protein Sequence:NP_061374.1Re-query CCDS DB by Nucleotide ID:NM_018886Re-query CCDS DB by Protein ID:NP_061374Link to BLAST:NP_061374.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001185972.1 316 Q9JL15 316 100% 0 0
NP_061374.1 316 Q9JL15 316 100% 0 0

Chromosomal Locations for CCDS 36592.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 13 (NC_000079.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13See the combined annotation on chromosome 13 in Sequence Viewer

Chromosome Start Stop Links
13 12440845 12440994 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 12447147 12447312 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 12448419 12448507 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 12451401 12451427 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 12452722 12452778 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 12453285 12453404 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 12454735 12454945 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 12456344 12456432 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13
13 12459174 12459215 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13Link to Vega Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (951 nt):
ATGTTGTCCTTAAATAACCTACAAAATATCATCTATAACCCGATAATCCCCTATGTTGGCACCATTACTG
AG
CAATTGAAGCCTGGCTCTCTGATTGTAATCCGTGGGCATGTCCCTAAAGATTCAGAAAGATTCCAGGT
T
GACTTTCAGCTGGGCAACAGCCTGAAGCCAAGAGCAGACGTGGCCTTCCACTTTAACCCTCGGTTCAAA
AGG
TCTAGCTGCATTGTTTGTAACACACTGACACAGGAGAAGTGGGGCTGGGAGGAGATCACCTACGACA
TG
CCCTTCAGAAAAGAAAAGTCCTTTGAGATCGTGTTCATGGTGCTCAAGAACAAATTCCAGGTGGCTGT
G
AACGGAAGGCATGTTCTGCTGTACGCCCACAGGATCAGCCCGGAGCAGATCGACACAGTGGGCATCTAC
GGC
AAAGTGAACATCCACTCCATCGGGTTCAGATTCAGCTCGGATTTACAGAGTATGGAAACATCTGCTC
TG
GGACTGACACAGATAAACAGAGAGAATATACAAAAGCCAGGCAAGCTCCAGCTGAGCCTGCCATTTGA
A
GCAAGGTTGAATGCCTCCATGGGTCCTGGACGAACCGTTGTCATTAAAGGGGAAGTGAACACCAATGCC
CGA
AGCTTTAATGTTGACCTAGTGGCAGGAAAAACAAGGGATATCGCTCTGCACTTGAACCCACGCCTCA
AT
GTGAAAGCATTTGTAAGAAATTCCTTTCTTCAGGATGCCTGGGGAGAAGAGGAGAGAAATATTACCTG
C
TTCCCATTTAGTTCTGGGATGTACTTTGAGATGATAATCTACTGTGATGTCCGGGAATTCAAGGTTGCT
ATA
AATGGTGTGCACAGCCTGGAGTACAAACACAGATTTAAAGACCTAAGCAGTATTGATACACTATCAG
TC
GATGGTGATATCCGTTTGCTGGATGTAAGGAGCTGGTAG


Translation (316 aa):
MLSLNNLQNIIYNPIIPYVGTITEQLKPGSLIVIRGHVPKDSERFQVDFQLGNSLKPRADVAFHFNPRFK
R
SSCIVCNTLTQEKWGWEEITYDMPFRKEKSFEIVFMVLKNKFQ
VAVNGRHVLLYAHRISPEQIDTVGIY
G
KVNIHSIGFRFSS
DLQSMETSALGLTQINRENIQKPGKLQLSLPFEARLNASMGPGRTVVIKGEVNTNA
R
SFNVDLVAGKTRDIALHLNPRLNVKAFVRNSFLQDAWGEEERNITCFPFSSGMYFEMIIYCDVREFKVA
I
NGVHSLEYKHRFKDLSSIDTLSVDGDIRLLDVRSW




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser