NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS24471.1 (previous version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
24471.1 Public Mus musculus 11 B3gnt2 16 104 75 CCDS HistoryNCBI Gene:53625Re-query CCDS DB by CCDS ID:24471.1Re-query CCDS DB by GeneID:53625See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 24471.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000055549 ENSMUSP00000053528 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000055549Link to Ensembl Protein Viewer:ENSMUSP00000053528Re-query CCDS DB by Nucleotide ID:ENSMUST00000055549Re-query CCDS DB by Protein ID:ENSMUSP00000053528
Original member Current member EBI,WTSI ENSMUST00000062844 ENSMUSP00000060247 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000062844Link to Ensembl Protein Viewer:ENSMUSP00000060247Re-query CCDS DB by Nucleotide ID:ENSMUST00000062844Re-query CCDS DB by Protein ID:ENSMUSP00000060247
Original member Current member EBI,WTSI OTTMUST00000011735 OTTMUSP00000005434 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000011735Link to Vega Protein Viewer:OTTMUSP00000005434Re-query CCDS DB by Nucleotide ID:OTTMUST00000011735Re-query CCDS DB by Protein ID:OTTMUSP00000005434
Original member Current member EBI,WTSI OTTMUST00000011736 OTTMUSP00000005435 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000011736Link to Vega Protein Viewer:OTTMUSP00000005435Re-query CCDS DB by Nucleotide ID:OTTMUST00000011736Re-query CCDS DB by Protein ID:OTTMUSP00000005435
Original member Current member NCBI NM_001169114.1 NP_001162585.1 Accepted alive Link to Nucleotide Sequence:NM_001169114.1Link to Protein Sequence:NP_001162585.1Re-query CCDS DB by Nucleotide ID:NM_001169114Re-query CCDS DB by Protein ID:NP_001162585Link to BLink:NP_001162585.1
Original member Current member NCBI NM_016888.5 NP_058584.3 Accepted alive Link to Nucleotide Sequence:NM_016888.5Link to Protein Sequence:NP_058584.3Re-query CCDS DB by Nucleotide ID:NM_016888Re-query CCDS DB by Protein ID:NP_058584Link to BLink:NP_058584.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001162585.1 397 Q9Z222 397 100% 0 0
NP_058584.3 397 Q9Z222 397 100% 0 0

Chromosomal Locations for CCDS 24471.1

Assembly GRCm38.p2 (GCF_000001635.22)

On '-' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 11Link to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 22835993 22837186 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1194 nt):
ATGAGTGTGGGGCGTCGAAGAGTCAAGTTGCTGGGCATCCTGATGATGGCAAATGTCTTCATTTATTTGA
TT
GTGGAAGTCTCCAAAAACAGTAGCCAAGACAAAAATGGAAAGGGAGGAGTAATAATCCCGAAAGAGAA
G
TTCTGGAAGCCACCCAGCACTCCCCGGGCATACTGGAACAGGGAACAGGAGAAGCTGAACAGGTGGTAC
AAT
CCCATCTTGAACAGGGTGGCCAATCAGACAGGGGAGCTAGCCACATCTCCAAACACAAGTCACCTGA
GC
TATTGTGAACCAGACTCGACGGTCATGACAGCTGTGACAGATTTTAATAATCTGCCGGACAGATTTAA
A
GACTTTCTCTTGTATTTGAGATGCCGGAATTACTCGCTGCTTATAGATCAACCGAAGAAATGTGCAAAG
AAG
CCCTTCTTACTATTGGCGATAAAGTCCCTCATTCCACATTTTGCCAGAAGGCAAGCAATTCGGGAGT
CT
TGGGGCCGAGAAACCAACGTAGGGAACCAGACAGTAGTGAGGGTCTTCCTGTTGGGCAAGACACCCCC
A
GAGGACAACCACCCTGACCTTTCGGACATGCTTAAGTTTGAGAGTGACAAGCACCAGGACATCCTCATG
TGG
AACTATAGAGACACATTCTTCAACCTGTCCCTGAAGGAAGTGCTGTTTCTTAGGTGGGTGAGCACTT
CC
TGTCCAGACGCAGAGTTTGTCTTCAAGGGCGATGATGACGTGTTTGTGAACACCCATCACATCCTTAA
T
TACTTGAATAGCTTATCCAAGAGCAAAGCCAAAGACTTGTTCATAGGTGACGTGATCCACAATGCTGGG
CCT
CACCGGGATAAGAAACTGAAGTACTACATCCCAGAAGTCTTCTACACCGGCGTCTACCCACCGTATG
CC
GGGGGTGGTGGATTCCTGTACTCCGGCCCCCTTGCCTTGAGGCTGTACAGTGCGACTAGCCGGGTCCA
T
CTCTACCCTATTGATGATGTTTATACGGGAATGTGCCTTCAGAAACTGGGCCTTGTTCCAGAGAAGCAC
AAA
GGCTTCAGGACATTTGATATTGAAGAGAAAAATAAGAAAAATATTTGTTCCTATATAGACCTAATGT
TA
GTACATAGCAGAAAACCTCAAGAGATGATTGATATCTGGTCTCAGTTGCAAAGTCCTAATTTAAAATG
C
TGA


Translation (397 aa):
MSVGRRRVKLLGILMMANVFIYLIVEVSKNSSQDKNGKGGVIIPKEKFWKPPSTPRAYWNREQEKLNRWY
N
PILNRVANQTGELATSPNTSHLSYCEPDSTVMTAVTDFNNLPDRFKDFLLYLRCRNYSLLIDQPKKCAK
K
PFLLLAIKSLIPHFARRQAIRESWGRETNVGNQTVVRVFLLGKTPPEDNHPDLSDMLKFESDKHQDILM
W
NYRDTFFNLSLKEVLFLRWVSTSCPDAEFVFKGDDDVFVNTHHILNYLNSLSKSKAKDLFIGDVIHNAG
P
HRDKKLKYYIPEVFYTGVYPPYAGGGGFLYSGPLALRLYSATSRVHLYPIDDVYTGMCLQKLGLVPEKH
K
GFRTFDIEEKNKKNICSYIDLMLVHSRKPQEMIDIWSQLQSPNLKC




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser